Gene Information

Name : GM18_0272 (GM18_0272)
Accession : YP_004197037.1
Strain : Geobacter sp. M18
Genome accession: NC_014973
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 328839 - 329513 bp
Length : 675 bp
Strand : +
Note : KEGG: gem:GM21_0227 two component transcriptional regulator, winged helix family; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver; transcriptional regulator domain-containing prote

DNA sequence :
ATGAGAATTCTGGTGGTTGAAGACGAAAAAAAGGTTGCCAGCTTCATTAAGCGCGGGCTCGAGGAAGAGCAGTACGAAGT
CCACACGGCCGCTGACGGTGAAGAGGGGCTTAAGCTTGCGCTGGAGAAGCCGTTCGATCTGGTCGTGCTCGACTGGATGC
TCCCGAAAAAGGACGGTCTTTCCGTTCTGAAGGAGCTCAGGGAGAGGAAAAATGTCACCCCGATCCTGATGCTTACCGCA
AAGGATTCCGTGGAAGATATCGTGGCAGGTCTGGACTCCGGTTCCGACGACTACCTGACCAAGCCGTTCGCCTTTGCCGA
GCTTTTGGCCCGCGTCCGTGCGCTGATGAGAAGGAGCGAACTCGACCGCGGCGCCGAGATCCGTTTCGCCGACCTGCGCC
TCGACCCGGTCACCCACAAGGTGTGGCGCAAGGACAAGGAGATCGATCTCACCGCGAAGGAGTACGGCCTGCTCGAGTAC
TTCATGCGCAACCCGCACCAGGTGCTCACCAGGACCATGATCGCCGAGCACGTCTGGGATTACACCTTCGACAGCTTCAC
CAACATCATCGACGTCTACGTGAACTACCTGCGTAAGAAGATCGACCGTGAAGCCGACAAGAAGCTGATCCACACGGTGA
GGGGCGTGGGCTACATCCTCAAAGAAGAAGAGTAA

Protein sequence :
MRILVVEDEKKVASFIKRGLEEEQYEVHTAADGEEGLKLALEKPFDLVVLDWMLPKKDGLSVLKELRERKNVTPILMLTA
KDSVEDIVAGLDSGSDDYLTKPFAFAELLARVRALMRRSELDRGAEIRFADLRLDPVTHKVWRKDKEIDLTAKEYGLLEY
FMRNPHQVLTRTMIAEHVWDYTFDSFTNIIDVYVNYLRKKIDREADKKLIHTVRGVGYILKEEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-40 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-39 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator BAC0111 Protein 8e-49 49
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator BAC0308 Protein 9e-45 49
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-46 48
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-41 48
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-42 48
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator BAC0347 Protein 2e-43 46
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-37 45
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-46 45
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 5e-36 44
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 7e-40 43
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 7e-40 43
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 7e-40 43
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 7e-40 43
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 7e-40 43
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 7e-40 43
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 7e-40 43
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 7e-40 43
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-38 43
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-38 43
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 6e-38 43
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-38 43
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-38 43
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-38 43
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-38 43
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-38 43
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-38 43
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-38 43
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 3e-30 42
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 6e-35 42
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-32 42
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 8e-40 41
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator NC_008702.1.4607594. Protein 3e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-52 51
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-40 46
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator VFG1386 Protein 6e-46 44
GM18_0272 YP_004197037.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-40 42