Gene Information

Name : STMMW_02831 (STMMW_02831)
Accession : YP_005231356.1
Strain : Salmonella enterica D23580
Genome accession: NC_016854
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 318124 - 318507 bp
Length : 384 bp
Strand : +
Note : tmhmm; query 1-128

DNA sequence :
GTGGATACTGCCGTGAAATGGTTAATATTAGTTACTTTCAGCATAAGTGGAATGCTGGTATGGCAGCCATCCTTTGCACA
AGAAGCATTGACCACACAATATTCACAGTCGGAACTCTTAAAAAATTGGGCGCTGAGTCATTGTCTGGCATTAGTATACA
AAGATGATGTCGTTAAAAACGATGCCAGAGCTACGGCCAGTGCTTACCTTGAATATGGTAAACAATCTGTGGAGATTTAC
CATGAAATTGATGAGATTGCGAAAAAATATTCAGGGTTGAAATATAACGGTTCGATATCATCAGATTTTAATACCATGAA
GTGCATAGATTTTATCCATGACAGGGAATTAAATGAATTAATTAAAAGGCGTGTCGAGAAGTAA

Protein sequence :
MDTAVKWLILVTFSISGMLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYLEYGKQSVEIY
HEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK