Gene Information

Name : DAMO_2877 (DAMO_2877)
Accession : YP_003207749.1
Strain : Candidatus Methylomirabilis oxyfera
Genome accession: NC_013260
Putative virulence/resistance : Virulence
Product : two-component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2482500 - 2483177 bp
Length : 678 bp
Strand : -
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId : 11004187, 11283292, 11399769; Product type pr : putative regulator

DNA sequence :
ATGAGACTCCTGCTAGTCGAAGACGATCAAAAGGCTGCGCGTGTCCTAAAGAAGGGGCTGGCCGAGGAGGGCGTGGTCGT
TGACATCGCCAATTCCGGCGACGAAGGTGAATATCTCGCTTCCGTGAACGACTACGATGTGATCGTCCTTGACTGGCTTC
TGCCCGGAAAAGACGGGATTCAACTCTGCCGTGAACTGCGAGCCCGCGGTCTCTCCACGCCCATTCTGATGGTAACGGCA
AAGGATGCCCTTCGAGACCGAATCAAGGGACTCGATACCGGAGCGGACGACTACATGGTGAAGCCGTTCGCCTTCGCCGA
GTTACTTGCCAGAATTCGAGCGCTTATGAGACGTGGGACGGGTCCGCGGCCGACGATGCTTCGAGTGGCCGATCTCGTCA
TTGATCCGGCCAGCCATCGCGTCACTCGCGGCGGGGCCAGCATCAAGTTGACTACGAAGGAATATGCCATCATCGAGTTC
CTGGCGCGCCGCGTCGGAGAGGTTGTCACCCGCACCACGTTGGGCGAGCACATCTGGGAAGACGAGTTCGACAACCTGAC
CAACCTTGTCGATGTGCATATCAGCAATCTGAGAAAGAAGATCGATGCCGGCTCAACGGTTTCGCTTATCCATACCGTGC
GCGGCCGCGGATATCGGTTGAGTGAGGAGCAGGAGTAA

Protein sequence :
MRLLLVEDDQKAARVLKKGLAEEGVVVDIANSGDEGEYLASVNDYDVIVLDWLLPGKDGIQLCRELRARGLSTPILMVTA
KDALRDRIKGLDTGADDYMVKPFAFAELLARIRALMRRGTGPRPTMLRVADLVIDPASHRVTRGGASIKLTTKEYAIIEF
LARRVGEVVTRTTLGEHIWEDEFDNLTNLVDVHISNLRKKIDAGSTVSLIHTVRGRGYRLSEEQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-41 47
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-41 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DAMO_2877 YP_003207749.1 two-component transcriptional regulator BAC0125 Protein 2e-48 51
DAMO_2877 YP_003207749.1 two-component transcriptional regulator BAC0111 Protein 8e-49 49
DAMO_2877 YP_003207749.1 two-component transcriptional regulator BAC0197 Protein 2e-45 48
DAMO_2877 YP_003207749.1 two-component transcriptional regulator BAC0308 Protein 1e-44 47
DAMO_2877 YP_003207749.1 two-component transcriptional regulator BAC0347 Protein 5e-43 47
DAMO_2877 YP_003207749.1 two-component transcriptional regulator BAC0083 Protein 2e-45 46
DAMO_2877 YP_003207749.1 two-component transcriptional regulator BAC0638 Protein 3e-38 45
DAMO_2877 YP_003207749.1 two-component transcriptional regulator NC_002952.2859858.p0 Protein 8e-35 42
DAMO_2877 YP_003207749.1 two-component transcriptional regulator NC_007622.3794948.p0 Protein 8e-35 42
DAMO_2877 YP_003207749.1 two-component transcriptional regulator NC_003923.1003417.p0 Protein 8e-35 42
DAMO_2877 YP_003207749.1 two-component transcriptional regulator NC_013450.8614146.p0 Protein 8e-35 42
DAMO_2877 YP_003207749.1 two-component transcriptional regulator NC_002951.3238224.p0 Protein 8e-35 42
DAMO_2877 YP_003207749.1 two-component transcriptional regulator NC_007793.3914065.p0 Protein 8e-35 42
DAMO_2877 YP_003207749.1 two-component transcriptional regulator NC_002758.1121390.p0 Protein 8e-35 42
DAMO_2877 YP_003207749.1 two-component transcriptional regulator NC_010079.5776364.p0 Protein 8e-35 42
DAMO_2877 YP_003207749.1 two-component transcriptional regulator AE000516.2.gene3505. Protein 3e-29 42
DAMO_2877 YP_003207749.1 two-component transcriptional regulator Y16952.3.orf35.gene. Protein 4e-27 41
DAMO_2877 YP_003207749.1 two-component transcriptional regulator HE999704.1.gene1528. Protein 2e-28 41
DAMO_2877 YP_003207749.1 two-component transcriptional regulator U82965.2.orf14.gene. Protein 1e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DAMO_2877 YP_003207749.1 two-component transcriptional regulator VFG0596 Protein 5e-42 47
DAMO_2877 YP_003207749.1 two-component transcriptional regulator VFG1390 Protein 2e-38 41