Gene Information

Name : Haur_2799 (Haur_2799)
Accession : YP_001545565.1
Strain : Herpetosiphon aurantiacus DSM 785
Genome accession: NC_009972
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3558772 - 3559482 bp
Length : 711 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: rrs:RoseRS_2290 two component transcriptional regulator, winged helix family

DNA sequence :
ATGAGCCAACCGCAAGCTGCTGCACGAATTTTGGTTGTTGAAGATGAAAAAGAAATTGCTGGCTATTTGCGGCGTGGTTT
GGCCTTCGAAGGTTTTACAGTTGAGGTCGCCCATGACGGGCCAACTGGGATTGCCGCCGCTCGTGAACGCCCCGCCGATC
TGGTGATTCTCGATATTATGTTGCCAGGCATGGATGGCTTTGAGGTTTGTCGGCGATTACGGGCTGGCAGCGATGTGCCA
ATTATTATGTTGACCGCCAAAGAAACGGTGCCCGACCGCGTGATGGGCTTAGAAAGTGGCGCAGATGATTATTTGATCAA
GCCGTTTGCCTTTGAAGAATTGTTAGCGCGAATTCGGGCCTTGCTGCGTCGCCATGTAGCCCGCACCGAAGGCCCAGTTG
TCTTGCAAGTCAATGGCTTGGAGATGAACACGGCTTCGCGCGAGGTCACAATTGCAGGCCGCGCTGTCCAACTTACTGCC
AAAGAATACGAATTGCTCGAATTATTTATGCGCCATCCAGGTCAAGTGCTAACCCGCGATGTCATTTATGATCGGGTTTG
GGGCTATGATTTCGGCGGCGAATCGAATATCATTGAGGTCTATGTGCGCTATCTGCGCCAAAAACTCGAAGAATCGGGCG
AAGGCCGCATGCTGCACACCGTGCGTGGAGCTGGCTACATTTTACGTGAACAACCCTACGGTGAACGATGA

Protein sequence :
MSQPQAAARILVVEDEKEIAGYLRRGLAFEGFTVEVAHDGPTGIAAARERPADLVILDIMLPGMDGFEVCRRLRAGSDVP
IIMLTAKETVPDRVMGLESGADDYLIKPFAFEELLARIRALLRRHVARTEGPVVLQVNGLEMNTASREVTIAGRAVQLTA
KEYELLELFMRHPGQVLTRDVIYDRVWGYDFGGESNIIEVYVRYLRQKLEESGEGRMLHTVRGAGYILREQPYGER

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-40 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-39 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Haur_2799 YP_001545565.1 two component transcriptional regulator BAC0347 Protein 3e-38 47
Haur_2799 YP_001545565.1 two component transcriptional regulator BAC0197 Protein 4e-42 47
Haur_2799 YP_001545565.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-39 47
Haur_2799 YP_001545565.1 two component transcriptional regulator BAC0083 Protein 7e-43 46
Haur_2799 YP_001545565.1 two component transcriptional regulator BAC0308 Protein 2e-42 46
Haur_2799 YP_001545565.1 two component transcriptional regulator BAC0638 Protein 1e-34 46
Haur_2799 YP_001545565.1 two component transcriptional regulator BAC0111 Protein 6e-42 45
Haur_2799 YP_001545565.1 two component transcriptional regulator BAC0125 Protein 3e-43 45
Haur_2799 YP_001545565.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-42 44
Haur_2799 YP_001545565.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-42 44
Haur_2799 YP_001545565.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-42 44
Haur_2799 YP_001545565.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-42 44
Haur_2799 YP_001545565.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-42 44
Haur_2799 YP_001545565.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-42 44
Haur_2799 YP_001545565.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-42 44
Haur_2799 YP_001545565.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-42 44
Haur_2799 YP_001545565.1 two component transcriptional regulator AE015929.1.gene1106. Protein 6e-39 43
Haur_2799 YP_001545565.1 two component transcriptional regulator HE999704.1.gene1528. Protein 4e-44 42
Haur_2799 YP_001545565.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-33 42
Haur_2799 YP_001545565.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-32 42
Haur_2799 YP_001545565.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Haur_2799 YP_001545565.1 two component transcriptional regulator VFG1390 Protein 1e-50 50
Haur_2799 YP_001545565.1 two component transcriptional regulator VFG1386 Protein 1e-44 47
Haur_2799 YP_001545565.1 two component transcriptional regulator VFG1389 Protein 3e-41 46
Haur_2799 YP_001545565.1 two component transcriptional regulator VFG0596 Protein 3e-40 44