Gene Information

Name : Athe_0280 (Athe_0280)
Accession : YP_002572201.1
Strain : Caldicellulosiruptor bescii DSM 6725
Genome accession: NC_012034
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 326124 - 326801 bp
Length : 678 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: mta:Moth_1478 two component transcriptional regulator

DNA sequence :
ATGAGAATTCTTGTAATTGAAGACCAAAAGTCCTTAGCAAATACAATAGCAAGAAGGCTTCAAGAAGTAGGCTATAGTGT
AGATATGGCACTTGATGGACAAGAGGGATTAAATTTTATCCAAACTGCAAGCTATGACTTAATAATCCTTGACATAATGC
TACCTAAGATTGACGGCATAACTTTGCTAAAACTTGTGAGAAACAAAGGTGTCCAGACTCCTGTTTTGTGTCTGACTGCC
AAGGATTCTATAGAAGACAGGGTAACAGGGCTTGATGCCGGAGCAGACGATTATCTTGTAAAACCATTTTCTTTTGATGA
GCTTTTAGCAAGGGTAAGGGCTCTTTTGAGAAGATACAGCCAGATAAAAGACCCAATTATCCAGATAAAAGACCTTGTAA
TAGACACCAATTCCAGAAAGGTGACACGCGCAGGAAAGGTAATTGACCTTACATCAAAAGAGTATTCTGTTTTGGAATAC
TTGGCAAGAAACAAAGGAAGAGTACTTACACGCTCACAAATAGCTGAACATGTTTGGAACTATGACTTTGAAGGGACTTC
CAATATTGTAGATGTATATATACGATACCTCAGAAGAAAGATTGACGATGGTTTTCCTGAAAAGCTCATCCATACAATAA
GAGGTGTTGGGTATATGTTGAGGGATGAAAAAAGATGA

Protein sequence :
MRILVIEDQKSLANTIARRLQEVGYSVDMALDGQEGLNFIQTASYDLIILDIMLPKIDGITLLKLVRNKGVQTPVLCLTA
KDSIEDRVTGLDAGADDYLVKPFSFDELLARVRALLRRYSQIKDPIIQIKDLVIDTNSRKVTRAGKVIDLTSKEYSVLEY
LARNKGRVLTRSQIAEHVWNYDFEGTSNIVDVYIRYLRRKIDDGFPEKLIHTIRGVGYMLRDEKR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-42 49
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-42 47
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 4e-28 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-45 50
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator BAC0111 Protein 7e-46 50
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-41 50
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator BAC0308 Protein 6e-42 49
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-37 48
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-37 48
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-37 48
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-37 48
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-37 48
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-37 48
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-37 48
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-37 48
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator BAC0083 Protein 6e-43 48
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator BAC0347 Protein 6e-40 48
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator BAC0638 Protein 3e-38 47
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 8e-34 46
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-37 46
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-32 45
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-32 45
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-32 45
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-32 45
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-32 45
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-32 45
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-32 45
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-32 45
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-32 45
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-32 45
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 2e-28 42
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator AE016830.1.gene2255. Protein 1e-26 41
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator U35369.1.gene1.p01 Protein 1e-26 41
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 8e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator VFG0596 Protein 7e-43 49
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-44 47
Athe_0280 YP_002572201.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-37 42