Gene Information

Name : CFSAN002069_14240 (CFSAN002069_14240)
Accession : YP_008251626.1
Strain : Salmonella enterica CFSAN002069
Genome accession: NC_021812
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2979886 - 2980566 bp
Length : 681 bp
Strand : +
Note : response regulator in two-component regulatory system with QseC; regulates FlhCD which is the master regulator for flagella and motility genes; Derived by automated computational analysis using gene prediction method: Protein Homology.

DNA sequence :
ATGCAGCGTATTTTAATCATTGAAGACGAACAAAAAACAGGTCGTTACCTGCAGCAGGGACTGGTTGAGGAAGGCTATCA
GGCCGATCTCTTTAATAATGGCCGCGATGGTCTCGGGGCCGCGTCGAAGGGACAGTATGATTTGATAATACTGGACGTGA
TGCTGCCTTTCCTCGACGGGTGGCAAATCATCAGCGCACTGAGGGAGTCCGGGCACGAAGAACCGGTCCTGTTTTTAACC
GCAAAGGACAACGTGCGGGACAAAGTGAAAGGACTGGAGCTTGGCGCAGATGACTACCTGATTAAGCCCTTTGATTTTAC
GGAGCTGGTTGCACGTGTAAGAACCCTACTGCGCCGGGCACGCTCGCAGGCCGCAACAGTCTGCACCATCGCCGATATGA
CCGTTGATATGGTGCGCCGGACCGTGATCCGTTCGGGGAAGAAGATCCATCTCACCGGTAAAGAATACGTTCTGCTTGAG
TTGCTGCTGCAACGCACCGGAGAAGTGTTACCCAGGAGTCTTATCTCGTCCCTGGTCTGGAACATGAATTTTGACAGTGA
TACGAATGTGATTGATGTCGCCGTGAGACGTCTGAGAAGTAAAATTGATGATGACTTTGAGCCAAAACTGATCCATACCG
TTCGCGGTGCCGGATATGTCCTGGAGATCAGAGAAGAGTGA

Protein sequence :
MQRILIIEDEQKTGRYLQQGLVEEGYQADLFNNGRDGLGAASKGQYDLIILDVMLPFLDGWQIISALRESGHEEPVLFLT
AKDNVRDKVKGLELGADDYLIKPFDFTELVARVRTLLRRARSQAATVCTIADMTVDMVRRTVIRSGKKIHLTGKEYVLLE
LLLQRTGEVLPRSLISSLVWNMNFDSDTNVIDVAVRRLRSKIDDDFEPKLIHTVRGAGYVLEIREE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-49 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-48 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CFSAN002069_14240 YP_008251626.1 transcriptional regulator BAC0308 Protein 1e-95 99
CFSAN002069_14240 YP_008251626.1 transcriptional regulator BAC0638 Protein 2e-55 64
CFSAN002069_14240 YP_008251626.1 transcriptional regulator BAC0083 Protein 5e-59 62
CFSAN002069_14240 YP_008251626.1 transcriptional regulator BAC0197 Protein 1e-59 62
CFSAN002069_14240 YP_008251626.1 transcriptional regulator BAC0111 Protein 8e-57 60
CFSAN002069_14240 YP_008251626.1 transcriptional regulator BAC0125 Protein 6e-55 57
CFSAN002069_14240 YP_008251626.1 transcriptional regulator BAC0347 Protein 2e-49 55
CFSAN002069_14240 YP_008251626.1 transcriptional regulator NC_007793.3914065.p0 Protein 2e-30 43
CFSAN002069_14240 YP_008251626.1 transcriptional regulator NC_007622.3794948.p0 Protein 2e-30 43
CFSAN002069_14240 YP_008251626.1 transcriptional regulator NC_002951.3238224.p0 Protein 2e-30 43
CFSAN002069_14240 YP_008251626.1 transcriptional regulator NC_002952.2859858.p0 Protein 2e-30 43
CFSAN002069_14240 YP_008251626.1 transcriptional regulator NC_013450.8614146.p0 Protein 2e-30 43
CFSAN002069_14240 YP_008251626.1 transcriptional regulator NC_010079.5776364.p0 Protein 2e-30 43
CFSAN002069_14240 YP_008251626.1 transcriptional regulator NC_003923.1003417.p0 Protein 2e-30 43
CFSAN002069_14240 YP_008251626.1 transcriptional regulator NC_002758.1121390.p0 Protein 2e-30 43
CFSAN002069_14240 YP_008251626.1 transcriptional regulator HE999704.1.gene1528. Protein 2e-31 42
CFSAN002069_14240 YP_008251626.1 transcriptional regulator AE015929.1.gene1106. Protein 3e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CFSAN002069_14240 YP_008251626.1 transcriptional regulator VFG0596 Protein 5e-50 56
CFSAN002069_14240 YP_008251626.1 transcriptional regulator VFG1390 Protein 7e-35 43
CFSAN002069_14240 YP_008251626.1 transcriptional regulator VFG1389 Protein 2e-29 42