Gene Information

Name : Anacy_2842 (Anacy_2842)
Accession : YP_007157184.1
Strain : Anabaena cylindrica PCC 7122
Genome accession: NC_019771
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3234360 - 3235088 bp
Length : 729 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: naz:Aazo_0581

DNA sequence :
TTGGAAAGTCATAAAGAAAAAATCCTGGTAGTAGACGACGAAGCCAGCATTCGCCGGATTTTGGAAACACGCCTTTCCAT
GATTGGCTACGATGTAGTAACTGCTGGCGACGGAGAAGAAGCCTTAGAAATTTTTCGCAAAGCTGAACCGGACTTGGTAG
TTTTAGACGTAATGATGCCAAAGCTAGATGGCTATGGTGTTTGTCAAGAATTACGTAAAGAATCCGATGTTCCTATTATC
ATGTTAACAGCCTTAGGGGATGTAGCTGATCGCATCACCGGACTAGAATTAGGTGCTGATGACTATGTAGTTAAACCATT
CTCCCCCAAAGAATTAGAAGCTCGCATTCGCTCAGTATTACGAAGAGTAGATAAAACAGGTGCGACTGGTATTCCCAGTT
CTGGGGTAATTCATGTCGGGAATATCAAAATTGATACGAATAAGCGCCAAGTCTACAAAGGTGACGAGCGTATTCGCTTA
ACAGGTATGGAATTCAGCTTATTAGAGTTGTTAGTAAGTCGGTCTGGAGAAGCTTTTTCCCGTTCAGAAATTTTACAAGA
AGTTTGGGGATACACACCAGAACGCCACGTAGATACTCGCGTGGTAGATGTGCATATCTCCCGTTTACGGGCAAAATTAG
AAGATGATCCTAGTAACCCAGAACTGATTCTCACAGCTAGAGGTACTGGTTATCTTTTTCAACGCATACTGGAAGCGGGA
GAGGAATGA

Protein sequence :
MESHKEKILVVDDEASIRRILETRLSMIGYDVVTAGDGEEALEIFRKAEPDLVVLDVMMPKLDGYGVCQELRKESDVPII
MLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRRVDKTGATGIPSSGVIHVGNIKIDTNKRQVYKGDERIRL
TGMEFSLLELLVSRSGEAFSRSEILQEVWGYTPERHVDTRVVDVHISRLRAKLEDDPSNPELILTARGTGYLFQRILEAG
EE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-31 42
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 3e-37 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 4e-47 49
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 5e-47 49
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 5e-47 49
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 5e-47 49
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 3e-47 49
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 5e-47 49
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 5e-47 49
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 5e-47 49
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 4e-47 49
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 5e-47 49
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 5e-44 47
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 3e-43 46
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family BAC0125 Protein 2e-39 45
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-42 45
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family CP000675.2.gene1535. Protein 1e-37 42
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family BAC0083 Protein 2e-36 42
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 2e-25 42
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family BAC0197 Protein 4e-34 42
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family BAC0638 Protein 2e-28 42
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family CP000034.1.gene3671. Protein 3e-39 42
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 1e-35 41
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 1e-35 41
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 1e-35 41
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 1e-35 41
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 1e-35 41
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 1e-35 41
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 1e-35 41
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 1e-35 41
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family BAC0308 Protein 2e-36 41
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 2e-31 41
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family CP004022.1.gene3215. Protein 8e-35 41
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family BAC0533 Protein 3e-29 41
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family CP000034.1.gene3834. Protein 3e-28 41
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family CP000647.1.gene4257. Protein 3e-29 41
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family NC_002695.1.915041.p Protein 3e-28 41
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family CP001138.1.gene4273. Protein 1e-28 41
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 2e-40 41
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 2e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family VFG1390 Protein 5e-40 44
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family VFG1389 Protein 5e-33 44
Anacy_2842 YP_007157184.1 two component transcriptional regulator, winged helix family VFG0596 Protein 4e-31 42