Gene Information

Name : Ccur_00280 (Ccur_00280)
Accession : YP_003150443.1
Strain : Cryptobacterium curtum DSM 15641
Genome accession: NC_013170
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain protein and winged-helix DNA-binding domain protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 36965 - 37669 bp
Length : 705 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
ATGACTAAGATTCTCATTGTCGAGGATGAAGAAAAGATTGCGCGCTTTATTGAGCTCGAACTCAAGCACGAAGGTTACGA
GGTCGATAAGGCTTCAGATGGACGGTCTGGTGTCGAACAAGCTCTTTCAGCTGATTATGATCTTATTCTCCTCGACATCC
TTTTGCCCCAGATCAATGGATTAGAGGTATTGCGGCGTATCCGCCGAGAAAAGGACACGCCTACCATTATGCTTACCGCG
CGTGATGCCGTCATGGACAAGGTAGCCGGCCTTGATGCTGGTGCCGACGACTACTTGACAAAGCCTTTCGCGATCGAAGA
GTTGCTCGCTCGCATTCGCGTAGCTTTAAAGCACCACAAATCACCTGATCAACCGACTTCTCTTTCGCCTGAACCCACTG
CAACAAAAACCCTTTCCATAAAAGGTGTATTGCTCGATATTGACCGCCGCGAAGTTCGCGTCAACAGCGATCCGGTAGAG
TTGACCAACCGCGAATTTGAAGTACTACGCTGTCTCATGGAGCATGCGGGTGTAGTTATGCACCGCGAACGTATTGCTGC
CGATGCTCTCGGGTACGAATTTATGGGCGACTCCAACAACGTTGATGTACACATAGCGCATTTGCGCGCCAAAATTGACG
ATAAGCATGACATCAAGCTCATCAGCACCGTCCGAGGAGTGGGATATGTCATCCGTAAAGAATAA

Protein sequence :
MTKILIVEDEEKIARFIELELKHEGYEVDKASDGRSGVEQALSADYDLILLDILLPQINGLEVLRRIRREKDTPTIMLTA
RDAVMDKVAGLDAGADDYLTKPFAIEELLARIRVALKHHKSPDQPTSLSPEPTATKTLSIKGVLLDIDRREVRVNSDPVE
LTNREFEVLRCLMEHAGVVMHRERIAADALGYEFMGDSNNVDVHIAHLRAKIDDKHDIKLISTVRGVGYVIRKE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-39 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-39 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ccur_00280 YP_003150443.1 response regulator with CheY-like receiver domain protein and winged-helix DNA-binding domain protein AE015929.1.gene1106. Protein 1e-39 50
Ccur_00280 YP_003150443.1 response regulator with CheY-like receiver domain protein and winged-helix DNA-binding domain protein NC_007793.3914065.p0 Protein 5e-42 49
Ccur_00280 YP_003150443.1 response regulator with CheY-like receiver domain protein and winged-helix DNA-binding domain protein NC_007622.3794948.p0 Protein 5e-42 49
Ccur_00280 YP_003150443.1 response regulator with CheY-like receiver domain protein and winged-helix DNA-binding domain protein NC_002951.3238224.p0 Protein 5e-42 49
Ccur_00280 YP_003150443.1 response regulator with CheY-like receiver domain protein and winged-helix DNA-binding domain protein NC_002952.2859858.p0 Protein 5e-42 49
Ccur_00280 YP_003150443.1 response regulator with CheY-like receiver domain protein and winged-helix DNA-binding domain protein NC_013450.8614146.p0 Protein 5e-42 49
Ccur_00280 YP_003150443.1 response regulator with CheY-like receiver domain protein and winged-helix DNA-binding domain protein NC_010079.5776364.p0 Protein 5e-42 49
Ccur_00280 YP_003150443.1 response regulator with CheY-like receiver domain protein and winged-helix DNA-binding domain protein NC_003923.1003417.p0 Protein 5e-42 49
Ccur_00280 YP_003150443.1 response regulator with CheY-like receiver domain protein and winged-helix DNA-binding domain protein NC_002758.1121390.p0 Protein 5e-42 49
Ccur_00280 YP_003150443.1 response regulator with CheY-like receiver domain protein and winged-helix DNA-binding domain protein HE999704.1.gene1528. Protein 2e-42 49
Ccur_00280 YP_003150443.1 response regulator with CheY-like receiver domain protein and winged-helix DNA-binding domain protein AE016830.1.gene1681. Protein 5e-39 45
Ccur_00280 YP_003150443.1 response regulator with CheY-like receiver domain protein and winged-helix DNA-binding domain protein BAC0125 Protein 1e-33 44
Ccur_00280 YP_003150443.1 response regulator with CheY-like receiver domain protein and winged-helix DNA-binding domain protein BAC0197 Protein 6e-36 43
Ccur_00280 YP_003150443.1 response regulator with CheY-like receiver domain protein and winged-helix DNA-binding domain protein BAC0083 Protein 4e-36 41
Ccur_00280 YP_003150443.1 response regulator with CheY-like receiver domain protein and winged-helix DNA-binding domain protein NC_012469.1.7685629. Protein 3e-34 41
Ccur_00280 YP_003150443.1 response regulator with CheY-like receiver domain protein and winged-helix DNA-binding domain protein HE999704.1.gene2815. Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ccur_00280 YP_003150443.1 response regulator with CheY-like receiver domain protein and winged-helix DNA-binding domain protein VFG0596 Protein 1e-39 45