Gene Information

Name : Slin_2929 (Slin_2929)
Accession : YP_003387741.1
Strain : Spirosoma linguale DSM 74
Genome accession: NC_013730
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3537210 - 3537902 bp
Length : 693 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sfu:Sfum_2007 transcriptional regulator

DNA sequence :
ATGTATGTTGCCGATATGAAGATTCTGGTAGTAGAAGACGAGCCTAAACTTGCTTCATTTGTTAAGAAAGGGCTGGAAGA
GCAATCTTGCGAAGTGGATGTAGCCTATGACGGCCAGGTTGGGCGAAATATGGCGCTTAATAACCTATACGACGTTATCG
TGCTGGATATTAATCTGCCCAAGATGAACGGCTTCGATGTTGTTCAGTCAATCCGGCAGGAGAAAAACCGCACACCCGTT
CTGATGCTCACGGCAATGGGCTCTGTAGATGATAAGCTCACCGGTTTCGAAGCCGGCGCCGACGACTATCTGGTAAAACC
CTTTGAGTTCCGGGAGTTGATGGCACGGCTGCGGGCATTGACAAAGCGCAGTAGTGATGCCGGCATGCAGACCAATGTAC
TGAAGGTGGCAGACCTCGAACTGGATCTGAATGAAAAAGTAGCCCGTCGGGGTGACAAACGGATCGAACTGACGGCCAAA
GAATTTGGCTTGCTCGACTATCTCATGCGTAACCGGGGCCGGGTGGTCTCGCGCGTTGACATTGCCGAAAAAGTCTGGGA
TATTCACTTCGACACCGGTACGAACGTAATTGATGTGTACGTCAATTTCCTTCGAAAGAAAATCGATAAAGATTTCCCCA
CGAAGCTTATTCATACAGTTATTGGTATGGGATATATGCTGAAGGAAGACTAA

Protein sequence :
MYVADMKILVVEDEPKLASFVKKGLEEQSCEVDVAYDGQVGRNMALNNLYDVIVLDINLPKMNGFDVVQSIRQEKNRTPV
LMLTAMGSVDDKLTGFEAGADDYLVKPFEFRELMARLRALTKRSSDAGMQTNVLKVADLELDLNEKVARRGDKRIELTAK
EFGLLDYLMRNRGRVVSRVDIAEKVWDIHFDTGTNVIDVYVNFLRKKIDKDFPTKLIHTVIGMGYMLKED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-41 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-40 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Slin_2929 YP_003387741.1 transcriptional regulator BAC0125 Protein 1e-50 52
Slin_2929 YP_003387741.1 transcriptional regulator BAC0083 Protein 3e-50 50
Slin_2929 YP_003387741.1 transcriptional regulator BAC0111 Protein 6e-50 49
Slin_2929 YP_003387741.1 transcriptional regulator BAC0638 Protein 3e-43 49
Slin_2929 YP_003387741.1 transcriptional regulator BAC0197 Protein 4e-45 48
Slin_2929 YP_003387741.1 transcriptional regulator BAC0347 Protein 1e-44 47
Slin_2929 YP_003387741.1 transcriptional regulator BAC0308 Protein 9e-44 44
Slin_2929 YP_003387741.1 transcriptional regulator NC_007793.3914065.p0 Protein 2e-37 42
Slin_2929 YP_003387741.1 transcriptional regulator NC_007622.3794948.p0 Protein 2e-37 42
Slin_2929 YP_003387741.1 transcriptional regulator NC_002951.3238224.p0 Protein 2e-37 42
Slin_2929 YP_003387741.1 transcriptional regulator NC_002952.2859858.p0 Protein 2e-37 42
Slin_2929 YP_003387741.1 transcriptional regulator NC_013450.8614146.p0 Protein 2e-37 42
Slin_2929 YP_003387741.1 transcriptional regulator NC_010079.5776364.p0 Protein 2e-37 42
Slin_2929 YP_003387741.1 transcriptional regulator NC_003923.1003417.p0 Protein 2e-37 42
Slin_2929 YP_003387741.1 transcriptional regulator NC_002758.1121390.p0 Protein 2e-37 42
Slin_2929 YP_003387741.1 transcriptional regulator AE015929.1.gene1106. Protein 2e-32 42
Slin_2929 YP_003387741.1 transcriptional regulator HE999704.1.gene1528. Protein 1e-33 42
Slin_2929 YP_003387741.1 transcriptional regulator NC_002516.2.879194.p Protein 2e-28 41
Slin_2929 YP_003387741.1 transcriptional regulator Y16952.3.orf35.gene. Protein 4e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Slin_2929 YP_003387741.1 transcriptional regulator VFG0596 Protein 1e-41 45
Slin_2929 YP_003387741.1 transcriptional regulator VFG1389 Protein 3e-35 42