Gene Information

Name : CSSP291_21073 (CSSP291_21073)
Accession : YP_007442910.1
Strain :
Genome accession: NC_020261
Putative virulence/resistance : Virulence
Product : Transcriptional regulatory protein pcoR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 843 - 1382 bp
Length : 540 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
TTGATAATACTGGACGTGATGCTGCCTTTCCTCGACGGGTGGCAAATCATCAGCGCACTGAGGGAGTCCGGGCACGAAGA
ACCGGTCCTGTTTTTAACCGCAAAGGACAACGTGCGGGACAAAGTGAAAGGACTGGAGCTTGGCGCAGATGACTACCTGA
TTAAGCCCTTTGATTTTACGGAGCTGGTTGCACGTGTAAGAACCCTACTGCGCCGGGCACGCTCGCAGGCCGCAACAGTC
TGCACCATCGCCGATATGACCGTTGATATGGTGCGCCGGACCGTGATCCGTTCGGGGAAGAAGATCCATCTCACCGGCAA
AGAATACGTTCTGCTTGAGTTGCTGCTGCAACGCACCGGAGAAGTGTTACCCAGGAGTCTTATCTCGTCCCTGGTCTGGA
ACATGAATTTTGACAGTGATACGAATGTGATTGATGTCGCCGTGAGACGTCTGAGAAGTAAAATTGATGATGACTTTGAG
CCAAAACTGATCCATACCGTTCGCGGTGCCGGATATGTCCTGGAGATCAGAGAAGAGTGA

Protein sequence :
MIILDVMLPFLDGWQIISALRESGHEEPVLFLTAKDNVRDKVKGLELGADDYLIKPFDFTELVARVRTLLRRARSQAATV
CTIADMTVDMVRRTVIRSGKKIHLTGKEYVLLELLLQRTGEVLPRSLISSLVWNMNFDSDTNVIDVAVRRLRSKIDDDFE
PKLIHTVRGAGYVLEIREE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-39 57
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-38 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR BAC0308 Protein 5e-73 99
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR BAC0638 Protein 9e-43 66
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR BAC0083 Protein 5e-49 65
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR BAC0197 Protein 2e-47 64
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR BAC0111 Protein 1e-45 61
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR BAC0125 Protein 2e-43 59
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR BAC0347 Protein 1e-39 56
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR NC_007793.3914065.p0 Protein 4e-21 42
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR NC_007622.3794948.p0 Protein 4e-21 42
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR NC_002951.3238224.p0 Protein 4e-21 42
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR NC_002952.2859858.p0 Protein 4e-21 42
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR NC_013450.8614146.p0 Protein 4e-21 42
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR NC_010079.5776364.p0 Protein 4e-21 42
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR NC_003923.1003417.p0 Protein 4e-21 42
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR NC_002758.1121390.p0 Protein 4e-21 42
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR HE999704.1.gene1528. Protein 5e-22 42
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR NC_002952.2859905.p0 Protein 2e-20 42
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR NC_003923.1003749.p0 Protein 1e-20 42
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR NC_007793.3914279.p0 Protein 2e-20 42
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR NC_002951.3237708.p0 Protein 2e-20 42
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR NC_013450.8614421.p0 Protein 2e-20 42
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR NC_009782.5559369.p0 Protein 2e-20 42
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR NC_009641.5332272.p0 Protein 2e-20 42
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR NC_002745.1124361.p0 Protein 2e-20 42
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR NC_002758.1121668.p0 Protein 2e-20 42
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR NC_007622.3794472.p0 Protein 2e-20 42
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR AE000516.2.gene3505. Protein 7e-21 42
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR HE999704.1.gene2815. Protein 1e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR VFG0596 Protein 7e-40 57
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR VFG1390 Protein 4e-29 48
CSSP291_21073 YP_007442910.1 Transcriptional regulatory protein pcoR VFG1389 Protein 2e-26 45