Gene Information

Name : OmpR8 (TTE2689)
Accession : NP_624204.1
Strain : Thermoanaerobacter tengcongensis MB4
Genome accession: NC_003869
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2584635 - 2585330 bp
Length : 696 bp
Strand : -
Note : Best Blastp hit = gi|4104602|gb|AAD10263.1| (AF036966) putative response regulator [Lactobacillus sakei], score 278, E-value 3.00E-74

DNA sequence :
ATGAGCAGCAAGATTTTGATTGTGGACGATGAAAAACCGCTTGTGGACATAATAAAGTATAATTTAGAAAAAGAAGGTTA
CATAACTTTTGAAGCCTATGACGGCGAAGAAGCCGTAAAGATGGCAAAAGAACAAAACCCTGACCTCATAATATTGGATG
TGATGCTTCCTAAAATGGACGGTTTTACCGTTTTAAAGACTTTGCGGCAGTCCATGACAGTTCCAATTTTGATGCTCACT
GCAAAAGAGGAGGAAGTAGATAAAGTATTGGGACTGGAATTGGGAGCTGATGATTATATCACAAAGCCTTTTTCAATGAG
GGAGCTCGTAGCTCGCGTTAAAGCGAATTTGAGGCGGGTAAGTTTCAATGGCAGCGAGCAGAATCACATTATACGGATAA
AGAATTTGAAGATCGACATCTTAAAGTACAAAGTGGAGAAGAACAACAAAGAGATAGAGTTAACCTCCCGAGAATTCGAG
CTTTTGAGATTTCTCGTTTTAAACAAAGGGCTGGTCTTTTCAAGAGAGGCTCTTTTAGAAAAAGTGTGGGGTTACGAATA
TTTTGGCGATATTAGAACGGTGGACGTCACCATAAGGCGATTGAGAGAAAAAATAGAAGATGACCCGAGCAACCCAAAAT
TCATACACACAAAAAGAGGGGTTGGTTACTATTTTAGCGATGAAAAGCCGATTTAA

Protein sequence :
MSSKILIVDDEKPLVDIIKYNLEKEGYITFEAYDGEEAVKMAKEQNPDLIILDVMLPKMDGFTVLKTLRQSMTVPILMLT
AKEEEVDKVLGLELGADDYITKPFSMRELVARVKANLRRVSFNGSEQNHIIRIKNLKIDILKYKVEKNNKEIELTSREFE
LLRFLVLNKGLVFSREALLEKVWGYEYFGDIRTVDVTIRRLREKIEDDPSNPKFIHTKRGVGYYFSDEKPI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-36 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-38 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OmpR8 NP_624204.1 response regulator NC_012469.1.7685629. Protein 4e-59 59
OmpR8 NP_624204.1 response regulator NC_002952.2859905.p0 Protein 2e-52 55
OmpR8 NP_624204.1 response regulator NC_002745.1124361.p0 Protein 2e-52 55
OmpR8 NP_624204.1 response regulator NC_009782.5559369.p0 Protein 2e-52 55
OmpR8 NP_624204.1 response regulator NC_002951.3237708.p0 Protein 2e-52 55
OmpR8 NP_624204.1 response regulator NC_003923.1003749.p0 Protein 2e-52 55
OmpR8 NP_624204.1 response regulator NC_002758.1121668.p0 Protein 2e-52 55
OmpR8 NP_624204.1 response regulator NC_007622.3794472.p0 Protein 2e-52 55
OmpR8 NP_624204.1 response regulator NC_009641.5332272.p0 Protein 2e-52 55
OmpR8 NP_624204.1 response regulator NC_013450.8614421.p0 Protein 2e-52 55
OmpR8 NP_624204.1 response regulator NC_007793.3914279.p0 Protein 2e-52 55
OmpR8 NP_624204.1 response regulator HE999704.1.gene2815. Protein 3e-49 51
OmpR8 NP_624204.1 response regulator AM180355.1.gene1830. Protein 1e-41 48
OmpR8 NP_624204.1 response regulator NC_012469.1.7686381. Protein 7e-44 47
OmpR8 NP_624204.1 response regulator NC_014475.1.orf0.gen Protein 1e-41 47
OmpR8 NP_624204.1 response regulator NC_005054.2598277.p0 Protein 1e-41 47
OmpR8 NP_624204.1 response regulator AE000516.2.gene3505. Protein 2e-41 47
OmpR8 NP_624204.1 response regulator AE016830.1.gene1681. Protein 3e-45 46
OmpR8 NP_624204.1 response regulator DQ212986.1.gene4.p01 Protein 1e-41 46
OmpR8 NP_624204.1 response regulator CP000675.2.gene1535. Protein 3e-40 45
OmpR8 NP_624204.1 response regulator EU250284.1.orf4.gene Protein 1e-39 45
OmpR8 NP_624204.1 response regulator AF155139.2.orf0.gene Protein 6e-40 45
OmpR8 NP_624204.1 response regulator NC_002758.1121390.p0 Protein 2e-35 44
OmpR8 NP_624204.1 response regulator NC_010079.5776364.p0 Protein 2e-35 44
OmpR8 NP_624204.1 response regulator NC_002952.2859858.p0 Protein 2e-35 44
OmpR8 NP_624204.1 response regulator NC_007622.3794948.p0 Protein 2e-35 44
OmpR8 NP_624204.1 response regulator BAC0125 Protein 1e-40 44
OmpR8 NP_624204.1 response regulator NC_003923.1003417.p0 Protein 2e-35 44
OmpR8 NP_624204.1 response regulator NC_013450.8614146.p0 Protein 2e-35 44
OmpR8 NP_624204.1 response regulator NC_002951.3238224.p0 Protein 2e-35 44
OmpR8 NP_624204.1 response regulator NC_007793.3914065.p0 Protein 2e-35 44
OmpR8 NP_624204.1 response regulator AF162694.1.orf4.gene Protein 3e-37 44
OmpR8 NP_624204.1 response regulator AF130997.1.orf0.gene Protein 2e-39 44
OmpR8 NP_624204.1 response regulator BAC0308 Protein 9e-34 43
OmpR8 NP_624204.1 response regulator HE999704.1.gene1528. Protein 1e-32 43
OmpR8 NP_624204.1 response regulator BAC0197 Protein 5e-38 43
OmpR8 NP_624204.1 response regulator AE015929.1.gene1106. Protein 4e-28 42
OmpR8 NP_624204.1 response regulator FJ349556.1.orf0.gene Protein 4e-37 42
OmpR8 NP_624204.1 response regulator NC_002695.1.915041.p Protein 8e-31 42
OmpR8 NP_624204.1 response regulator CP000034.1.gene3834. Protein 8e-31 42
OmpR8 NP_624204.1 response regulator CP004022.1.gene1676. Protein 2e-29 42
OmpR8 NP_624204.1 response regulator CP001138.1.gene4273. Protein 7e-31 41
OmpR8 NP_624204.1 response regulator CP001918.1.gene5135. Protein 7e-26 41
OmpR8 NP_624204.1 response regulator CP004022.1.gene3215. Protein 3e-33 41
OmpR8 NP_624204.1 response regulator NC_002695.1.916589.p Protein 5e-32 41
OmpR8 NP_624204.1 response regulator CP001138.1.gene2239. Protein 3e-33 41
OmpR8 NP_624204.1 response regulator CP001918.1.gene3444. Protein 8e-32 41
OmpR8 NP_624204.1 response regulator BAC0039 Protein 6e-32 41
OmpR8 NP_624204.1 response regulator CP000647.1.gene2531. Protein 3e-32 41
OmpR8 NP_624204.1 response regulator BAC0596 Protein 3e-33 41
OmpR8 NP_624204.1 response regulator CP000034.1.gene2186. Protein 6e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OmpR8 NP_624204.1 response regulator VFG1389 Protein 5e-35 44
OmpR8 NP_624204.1 response regulator VFG0596 Protein 4e-37 41
OmpR8 NP_624204.1 response regulator VFG1563 Protein 2e-38 41
OmpR8 NP_624204.1 response regulator VFG1702 Protein 4e-38 41