Gene Information

Name : Desaci_0309 (Desaci_0309)
Accession : YP_006464713.1
Strain : Desulfosporosinus acidiphilus SJ4
Genome accession: NC_018068
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 313788 - 314465 bp
Length : 678 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
ATGGGTTCTAAAATATTGATTATAGAGGATGAAGAAAAAATTGCTCGCTTTATCGAGCTGGAACTTGGTTACGAAGGGTA
TCTAACCACTAAAGCTTTTGATGGCAGAACAGGGCTTGAACTCGCCGAATCCGGCGAGTTTGACCTCGTTTTGTTGGATG
TCATGCTGCCTAAGTTAAGCGGTATGGAAGTGCTGCGGAGAATTCGACGCACCTCCTCAATTCCTGTCATTCTTCTGACT
GCTCGGGACAGCGTCATGGATAAGGTTTTCGGCCTTGACAGCGGAGCGAGTGATTACATCACCAAACCCTTTGCCATTGA
AGAGCTTCTGGCTAGAATCCGTACAGCCCTCAGGAAAACAATGACCGAAGATACAGAAGTGTTGTCTGCCTCCGGACTAT
TGCTGGACACCGGTCGTCATACGGTTACTATGATGGGTAAACCTATTGATCTGACCAAACGCGAATTTGACCTTTTGCAC
TATCTGCTTAAAAATAAAGGCATTGTCGTTTCGCGGGAAGCGATGATCGAAAATGTCTGGGGCTTCGATTTCACAGGCGA
AACCAACGCCGTCGATGTCTACGTGCGTTTTCTGCGCGGTAAAATTGACGAGGTGTTCGATATCAAATTGATACATACCG
TAAGGGGAGTGGGATATGTGATTAAGGATGAAAAGTGA

Protein sequence :
MGSKILIIEDEEKIARFIELELGYEGYLTTKAFDGRTGLELAESGEFDLVLLDVMLPKLSGMEVLRRIRRTSSIPVILLT
ARDSVMDKVFGLDSGASDYITKPFAIEELLARIRTALRKTMTEDTEVLSASGLLLDTGRHTVTMMGKPIDLTKREFDLLH
YLLKNKGIVVSREAMIENVWGFDFTGETNAVDVYVRFLRGKIDEVFDIKLIHTVRGVGYVIKDEK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-47 48
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-45 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene1528. Protein 8e-47 52
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE015929.1.gene1106. Protein 1e-45 50
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 4e-49 49
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 4e-49 49
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 4e-49 49
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 4e-49 49
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 4e-49 49
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 4e-49 49
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 4e-49 49
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 4e-49 49
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0308 Protein 9e-44 46
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0197 Protein 4e-46 46
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0125 Protein 3e-45 45
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0638 Protein 4e-37 44
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0347 Protein 2e-37 43
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0111 Protein 3e-41 43
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain DQ212986.1.gene4.p01 Protein 3e-34 42
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 1e-34 42
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7685629. Protein 2e-39 41
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0083 Protein 7e-42 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG0596 Protein 3e-47 48
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1390 Protein 6e-43 44
Desaci_0309 YP_006464713.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1389 Protein 4e-35 41