Gene Information

Name : BA_3229 (BA_3229)
Accession : NP_845535.1
Strain : Bacillus anthracis Ames
Genome accession: NC_003997
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2973948 - 2974622 bp
Length : 675 bp
Strand : +
Note : 'similar to GP:17431126, and GP:17431126; identified by sequence similarity'

DNA sequence :
ATGCGAGTTCTTATTGTCGAAGATGAACAAGACTTACAAAATATATTAGTAAAGCGATTAAATGCAGAACATTATAGTGT
CGATGCATGCGGGAATGGAGAAGATGCCTTAGATTATATAAACATGGCTACCTACGATTTGATCGTGCTTGACATTATGA
TTCCCGGAATAAATGGTTTACAAGTATTACAAAAATTACGCGCGGACAATCATACAACTTCTGTCTTGCTTCTTACAGCT
AAAGATACAATTGATGATCGCGTAAAAGGACTCGACTTAGGTGCGGACGATTATTTAGTAAAGCCGTTCGCTTTTGACGA
ACTGCTAGCAAGAATTCGAGTGTTAATGCGAAGAAAAACAGGAAATACATCTAATGTGTTTGAAATTGCTGACCTAGTGG
TGGATTGCAATATGCATAAAGTAACAAGAGGAGACCAAGTTATTACTCTTTCCAGTAAAGAATTTGCTATTTTAGAATAT
ATGATTCGTAATAAAGAAGTTGTGTTGACACGAGATAAAATTGAGCAACATGTGTGGAATTACGACTATGAAGGTGGCTC
AAATATTATTGATGTTTACGTCCGCTATCTTCGAAAAAAAGTTGATAGCCAGTTTGAAACGAAGTTAATTCATACAGTAA
GAGGAACTGGTTACGTATTGCGAGTAGAATCATGA

Protein sequence :
MRVLIVEDEQDLQNILVKRLNAEHYSVDACGNGEDALDYINMATYDLIVLDIMIPGINGLQVLQKLRADNHTTSVLLLTA
KDTIDDRVKGLDLGADDYLVKPFAFDELLARIRVLMRRKTGNTSNVFEIADLVVDCNMHKVTRGDQVITLSSKEFAILEY
MIRNKEVVLTRDKIEQHVWNYDYEGGSNIIDVYVRYLRKKVDSQFETKLIHTVRGTGYVLRVES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-42 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-40 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BA_3229 NP_845535.1 DNA-binding response regulator BAC0111 Protein 6e-52 49
BA_3229 NP_845535.1 DNA-binding response regulator BAC0308 Protein 5e-49 48
BA_3229 NP_845535.1 DNA-binding response regulator BAC0125 Protein 1e-47 48
BA_3229 NP_845535.1 DNA-binding response regulator BAC0638 Protein 2e-46 48
BA_3229 NP_845535.1 DNA-binding response regulator BAC0347 Protein 8e-45 47
BA_3229 NP_845535.1 DNA-binding response regulator BAC0197 Protein 3e-49 47
BA_3229 NP_845535.1 DNA-binding response regulator NC_007793.3914065.p0 Protein 3e-41 45
BA_3229 NP_845535.1 DNA-binding response regulator NC_007622.3794948.p0 Protein 3e-41 45
BA_3229 NP_845535.1 DNA-binding response regulator NC_002951.3238224.p0 Protein 3e-41 45
BA_3229 NP_845535.1 DNA-binding response regulator NC_002952.2859858.p0 Protein 3e-41 45
BA_3229 NP_845535.1 DNA-binding response regulator NC_013450.8614146.p0 Protein 3e-41 45
BA_3229 NP_845535.1 DNA-binding response regulator NC_010079.5776364.p0 Protein 3e-41 45
BA_3229 NP_845535.1 DNA-binding response regulator NC_003923.1003417.p0 Protein 3e-41 45
BA_3229 NP_845535.1 DNA-binding response regulator NC_002758.1121390.p0 Protein 3e-41 45
BA_3229 NP_845535.1 DNA-binding response regulator BAC0083 Protein 2e-49 45
BA_3229 NP_845535.1 DNA-binding response regulator AE015929.1.gene1106. Protein 1e-36 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BA_3229 NP_845535.1 DNA-binding response regulator VFG1390 Protein 2e-48 45
BA_3229 NP_845535.1 DNA-binding response regulator VFG0596 Protein 3e-42 43
BA_3229 NP_845535.1 DNA-binding response regulator VFG1386 Protein 1e-45 42