Gene Information

Name : IroE (SC2707)
Accession : YP_217694.1
Strain : Salmonella enterica SC-B67
Genome accession: NC_006905
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : R : General function prediction only
COG ID : COG2819
EC number : -
Position : 2877297 - 2878232 bp
Length : 936 bp
Strand : +
Note : -

DNA sequence :
ATGTATGGTCGCCAGTACCACAACAAGCGCTATCGCATGGCGCTATTTTTAGTGAGTTTTTGTTTTAGCGCGCTGAGTTA
TGCGCAGCCGGATATGCAGCCATTAGGGCCGAATATCGCTGATAAAGGTTCGGGATATTACCATTTTAGGGTCAATGACT
TTCAATCTGCCGATGGCGCAAGACATTACCGGGTATGGACCGCTATCCCCAATAAAGCCGCCCCGCCGTCGGGTTATCCT
GTCTTATATATGCTGGACGGCAACGCAGTGATGGACAGACTGCCGGAGGCGCTGCTCAAACAACTGGCAGACCACTCGCC
GCCGGTGATTGTGGCGATTGGCTATCAGACTAACCTGCCGTTTGATCTTAACGGCAGAGCTTATGACTATACGCCGGCGC
CGGGAATCGATCGCGATGGCAGTGAAAATAACCCGCGTTTTCATCGTAAAACCGGCGGCGGGCCAGCGTTCCGCCAGCTA
CTGGAGAGGCATATCGCGCCGCAGGTGGAACAAGGAATAACCATCAACCCCGAACGGCGCGGGGTATGGGGACATTCTTA
TGGCGGCCTGTTCGTTTTGGACTCCTGGCTGTCGTCATCCTTCTTTCATATCTATTACAGCGCCAGCCCGTCACTCAGCA
GGGATAACTTTGCCCTGTTGAATCGCCTTACGGCAGTGAAGCCGTCGCCGTCCTGCCATAAAAAACTCATCATAATGGAA
GGTTCAGCGTCGAATGGGGATAACAGGCAACGCCAGATGGCCGAGCTCCTGCAAAAAGTTCAGGAGACCGTGAGAACGCT
TGAGAACAACGGCGTTAACGCGGCCCTGCAGCATTACCCGGGCATGGGCCACGGGCCCATGTTTAACGCCTCTTTTCGTA
GTGCATTGCTGGATATCAGTCGCGAACCGGCAAGCCAAGAACCACGCTGCCATTAA

Protein sequence :
MYGRQYHNKRYRMALFLVSFCFSALSYAQPDMQPLGPNIADKGSGYYHFRVNDFQSADGARHYRVWTAIPNKAAPPSGYP
VLYMLDGNAVMDRLPEALLKQLADHSPPVIVAIGYQTNLPFDLNGRAYDYTPAPGIDRDGSENNPRFHRKTGGGPAFRQL
LERHIAPQVEQGITINPERRGVWGHSYGGLFVLDSWLSSSFFHIYYSASPSLSRDNFALLNRLTAVKPSPSCHKKLIIME
GSASNGDNRQRQMAELLQKVQETVRTLENNGVNAALQHYPGMGHGPMFNASFRSALLDISREPASQEPRCH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
iroE CAC43425.1 IroE protein Virulence PAI III 536 Protein 4e-89 61

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
IroE YP_217694.1 hypothetical protein VFG1651 Protein 2e-89 61