Gene Information

Name : covR (MGAS1882_0310)
Accession : YP_005411068.1
Strain : Streptococcus pyogenes MGAS1882
Genome accession: NC_017053
Putative virulence/resistance : Virulence
Product : TCS signal transduction response regulator CovR/CsrR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 289064 - 289750 bp
Length : 687 bp
Strand : +
Note : CDD hit: specific, cl9944 = Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two

DNA sequence :
ATGACAAAGAAAATTTTAATTATTGAAGATGAAAAGAATCTGGCTAGATTCGTTTCTCTTGAGCTGCAACATGAGGGTTA
TGAAGTCATTGTTGAGGTCAATGGTCGTGAAGGGTTAGAAACTGCTTTGGAAAAAGAGTTTGATTTAATCCTGCTTGACT
TAATGTTACCAGAGATGGATGGTTTTGAAGTGACCCGTCGTTTGCAAACCGAAAAAACAACGTATATCATGATGATGACT
GCGCGTGATTCTATTATGGATGTGGTTGCAGGTTTAGACCGCGGTGCAGACGACTATATTGTTAAACCGTTTGCCATTGA
AGAACTACTTGCCCGTATTCGTGCTATTTTCCGCCGTCAAGATATTGAATCTGAGAAGAAAGTGCCTAGTCAAGGCATTT
ATCGAGATCTAGTTTTAAATCCACAAAACCGTTCAGTTAATCGTGGCGACGATGAGATTTCTCTCACTAAACGTGAATAT
GATTTGCTTAATATTTTGATGACTAATATGAATCGTGTCATGACACGTGAAGAATTATTGTCAAATGTTTGGAAATATGA
TGAAGCCGTTGAGACTAATGTTGTAGATGTCTATATTCGTTATCTCCGCGGCAAAATTGACATTCCAGGCAAGGAATCTT
ATATCCAAACAGTGCGTGGCATGGGATACGTTATTCGTGAGAAATAA

Protein sequence :
MTKKILIIEDEKNLARFVSLELQHEGYEVIVEVNGREGLETALEKEFDLILLDLMLPEMDGFEVTRRLQTEKTTYIMMMT
ARDSIMDVVAGLDRGADDYIVKPFAIEELLARIRAIFRRQDIESEKKVPSQGIYRDLVLNPQNRSVNRGDDEISLTKREY
DLLNILMTNMNRVMTREELLSNVWKYDEAVETNVVDVYIRYLRGKIDIPGKESYIQTVRGMGYVIREK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-37 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-36 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
covR YP_005411068.1 TCS signal transduction response regulator CovR/CsrR HE999704.1.gene1528. Protein 6e-59 62
covR YP_005411068.1 TCS signal transduction response regulator CovR/CsrR AE015929.1.gene1106. Protein 3e-49 54
covR YP_005411068.1 TCS signal transduction response regulator CovR/CsrR NC_003923.1003417.p0 Protein 3e-51 53
covR YP_005411068.1 TCS signal transduction response regulator CovR/CsrR NC_013450.8614146.p0 Protein 3e-51 53
covR YP_005411068.1 TCS signal transduction response regulator CovR/CsrR NC_002951.3238224.p0 Protein 3e-51 53
covR YP_005411068.1 TCS signal transduction response regulator CovR/CsrR NC_007793.3914065.p0 Protein 3e-51 53
covR YP_005411068.1 TCS signal transduction response regulator CovR/CsrR NC_002758.1121390.p0 Protein 3e-51 53
covR YP_005411068.1 TCS signal transduction response regulator CovR/CsrR NC_010079.5776364.p0 Protein 3e-51 53
covR YP_005411068.1 TCS signal transduction response regulator CovR/CsrR NC_002952.2859858.p0 Protein 3e-51 53
covR YP_005411068.1 TCS signal transduction response regulator CovR/CsrR NC_007622.3794948.p0 Protein 3e-51 53
covR YP_005411068.1 TCS signal transduction response regulator CovR/CsrR NC_012469.1.7685629. Protein 2e-38 43
covR YP_005411068.1 TCS signal transduction response regulator CovR/CsrR HE999704.1.gene2815. Protein 3e-39 42
covR YP_005411068.1 TCS signal transduction response regulator CovR/CsrR BAC0125 Protein 7e-36 41
covR YP_005411068.1 TCS signal transduction response regulator CovR/CsrR AE016830.1.gene1681. Protein 3e-39 41
covR YP_005411068.1 TCS signal transduction response regulator CovR/CsrR BAC0197 Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
covR YP_005411068.1 TCS signal transduction response regulator CovR/CsrR VFG1390 Protein 3e-41 43
covR YP_005411068.1 TCS signal transduction response regulator CovR/CsrR VFG0596 Protein 3e-37 43
covR YP_005411068.1 TCS signal transduction response regulator CovR/CsrR VFG1702 Protein 2e-33 41