Gene Information

Name : irlR (PST_3110)
Accession : YP_001173590.1
Strain : Pseudomonas stutzeri A1501
Genome accession: NC_009434
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3349057 - 3349575 bp
Length : 519 bp
Strand : -
Note : Code: TK; COG: COG0745

DNA sequence :
ATGCTGCCCGGGCTCGATGGCTGGCAGCTGGTGCAGGTGGTGCGCCAGCGCTCGGCGCACACGCCGGTGCTGTTCCTCAC
CGCCCGCGATGCGGTGGAAGACCGGGTGCGCGGTCTGGAACTGGGCGCCGACGACTACCTCATCAAACCCTTTTCCTACG
CCGAGCTGCTGGCGCGGGTGCGCACGTTGCTACGTCGCGGCCCGCCGCGGGAAGTCGAGCATTTCCACGTCGCCGACTTG
GAGCTGGACCTGCTGCGCCGCCGCGTCACCCGTCAAGGCGAGCGCATCAACCTGACCAACAAGGAGTTCGCCTTGCTGCA
CCTGCTGCTCAGCCGTCAGGGCGAGGTGCTGTCCCGTGCGCAGATCGCTTCGCAGGTCTGGCAGATGAACTTCGACAGCG
ATACCAATGTGGTCGACGTGGCGATCCGCCGGCTGCGCGCCAAGGTCGACGATCCGTACCCGCTCAAGCTCATCCACACC
GTGCGCGGCATGGGCTACGTGCTGGACGTCTCGGCATGA

Protein sequence :
MLPGLDGWQLVQVVRQRSAHTPVLFLTARDAVEDRVRGLELGADDYLIKPFSYAELLARVRTLLRRGPPREVEHFHVADL
ELDLLRRRVTRQGERINLTNKEFALLHLLLSRQGEVLSRAQIASQVWQMNFDSDTNVVDVAIRRLRAKVDDPYPLKLIHT
VRGMGYVLDVSA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-45 60

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
irlR YP_001173590.1 two-component response regulator BAC0125 Protein 3e-54 69
irlR YP_001173590.1 two-component response regulator BAC0197 Protein 1e-54 68
irlR YP_001173590.1 two-component response regulator BAC0638 Protein 8e-50 68
irlR YP_001173590.1 two-component response regulator BAC0083 Protein 3e-56 67
irlR YP_001173590.1 two-component response regulator BAC0308 Protein 9e-52 62
irlR YP_001173590.1 two-component response regulator BAC0111 Protein 4e-52 61
irlR YP_001173590.1 two-component response regulator BAC0347 Protein 2e-44 55
irlR YP_001173590.1 two-component response regulator HE999704.1.gene1528. Protein 5e-21 45
irlR YP_001173590.1 two-component response regulator NC_002952.2859905.p0 Protein 2e-27 45
irlR YP_001173590.1 two-component response regulator NC_009782.5559369.p0 Protein 1e-27 45
irlR YP_001173590.1 two-component response regulator NC_002951.3237708.p0 Protein 1e-27 45
irlR YP_001173590.1 two-component response regulator NC_003923.1003749.p0 Protein 3e-27 45
irlR YP_001173590.1 two-component response regulator NC_007622.3794472.p0 Protein 1e-27 45
irlR YP_001173590.1 two-component response regulator NC_002758.1121668.p0 Protein 1e-27 45
irlR YP_001173590.1 two-component response regulator NC_009641.5332272.p0 Protein 1e-27 45
irlR YP_001173590.1 two-component response regulator NC_013450.8614421.p0 Protein 1e-27 45
irlR YP_001173590.1 two-component response regulator NC_007793.3914279.p0 Protein 1e-27 45
irlR YP_001173590.1 two-component response regulator NC_002745.1124361.p0 Protein 1e-27 45
irlR YP_001173590.1 two-component response regulator AE000516.2.gene3505. Protein 3e-21 45
irlR YP_001173590.1 two-component response regulator NC_002952.2859858.p0 Protein 5e-30 44
irlR YP_001173590.1 two-component response regulator NC_007622.3794948.p0 Protein 5e-30 44
irlR YP_001173590.1 two-component response regulator NC_003923.1003417.p0 Protein 5e-30 44
irlR YP_001173590.1 two-component response regulator NC_013450.8614146.p0 Protein 5e-30 44
irlR YP_001173590.1 two-component response regulator NC_002951.3238224.p0 Protein 5e-30 44
irlR YP_001173590.1 two-component response regulator NC_007793.3914065.p0 Protein 5e-30 44
irlR YP_001173590.1 two-component response regulator NC_002758.1121390.p0 Protein 5e-30 44
irlR YP_001173590.1 two-component response regulator NC_010079.5776364.p0 Protein 5e-30 44
irlR YP_001173590.1 two-component response regulator AE015929.1.gene1106. Protein 4e-25 41
irlR YP_001173590.1 two-component response regulator NC_012469.1.7685629. Protein 2e-26 41
irlR YP_001173590.1 two-component response regulator BAC0487 Protein 2e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
irlR YP_001173590.1 two-component response regulator VFG0596 Protein 2e-45 60
irlR YP_001173590.1 two-component response regulator VFG1389 Protein 7e-31 48
irlR YP_001173590.1 two-component response regulator VFG1390 Protein 9e-32 46
irlR YP_001173590.1 two-component response regulator VFG0473 Protein 8e-26 41