Gene Information

Name : BC3200 (BC3200)
Accession : NP_832941.1
Strain : Bacillus cereus ATCC 14579
Genome accession: NC_004722
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3175320 - 3175994 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
ATGCGAGTTCTTATCGTCGAAGATGAACAAGACTTACAAAATATATTGGTGAAACGATTAAATGCAGAACATTATAGTGT
CGATGCATGTGGGAATGGAGAAGATGCCCTGGATTATATAAACATGGCTACCTACGATTTGATTGTCCTTGACATTATGA
TTCCCGGAATAGATGGTTTACACGTATTACAAAGATTACGCGCGGACAATAATGCAACTCCTGTCTTGCTTCTTACAGCT
AAAGATACAATTGATGATCGTGTAACAGGACTCGACTTAGGTGCAGATGATTATTTAGTAAAGCCGTTTGCTTTTGATGA
ACTGTTAGCAAGAATTCGAGTGTTAATGCGAAGAACAACAGGAAATACATCTAATGTATTTGAAATCGCTGACCTAGTGG
TAGATTGCAATATGCATAAAGTAACACGAGGAGACCAAGTTATCACTCTTTCCAGTAAAGAATTTGCAATTTTAGAATAT
ATGATTCGTAATAAAGAAGTTGTGCTGACACGAGATAAAATTGAGCAACATGTGTGGAATTACGACTATGACGGCGGATC
GAATATTATTGATGTTTACGTCCGCTATCTTCGTAAAAAAATTGATAGCCAGTTTGAAACGAAGTTAATTCATACAGTGC
GCGGAACTGGTTACGTATTGCGAGTAGAATCATGA

Protein sequence :
MRVLIVEDEQDLQNILVKRLNAEHYSVDACGNGEDALDYINMATYDLIVLDIMIPGIDGLHVLQRLRADNNATPVLLLTA
KDTIDDRVTGLDLGADDYLVKPFAFDELLARIRVLMRRTTGNTSNVFEIADLVVDCNMHKVTRGDQVITLSSKEFAILEY
MIRNKEVVLTRDKIEQHVWNYDYDGGSNIIDVYVRYLRKKIDSQFETKLIHTVRGTGYVLRVES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-41 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-40 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BC3200 NP_832941.1 two-component response regulator BAC0111 Protein 3e-52 50
BC3200 NP_832941.1 two-component response regulator BAC0308 Protein 5e-49 49
BC3200 NP_832941.1 two-component response regulator BAC0125 Protein 4e-48 49
BC3200 NP_832941.1 two-component response regulator BAC0638 Protein 1e-46 49
BC3200 NP_832941.1 two-component response regulator BAC0197 Protein 2e-49 48
BC3200 NP_832941.1 two-component response regulator BAC0083 Protein 7e-50 47
BC3200 NP_832941.1 two-component response regulator BAC0347 Protein 5e-45 46
BC3200 NP_832941.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-41 44
BC3200 NP_832941.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-41 44
BC3200 NP_832941.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-41 44
BC3200 NP_832941.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-41 44
BC3200 NP_832941.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-41 44
BC3200 NP_832941.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-41 44
BC3200 NP_832941.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-41 44
BC3200 NP_832941.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-41 44
BC3200 NP_832941.1 two-component response regulator BAC0487 Protein 7e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BC3200 NP_832941.1 two-component response regulator VFG1390 Protein 3e-49 46
BC3200 NP_832941.1 two-component response regulator VFG1386 Protein 3e-47 43
BC3200 NP_832941.1 two-component response regulator VFG0596 Protein 1e-41 42