Gene Information

Name : grlA (ROD_30051)
Accession : YP_003366511.1
Strain : Citrobacter rodentium ICC168
Genome accession: NC_013716
Putative virulence/resistance : Virulence
Product : GrlA, global regulator of LEE activator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3173861 - 3174268 bp
Length : 408 bp
Strand : -
Note : positive regulator of LEE gene expression

DNA sequence :
ATGGAATCTAAAAATAGTGACTATGTAATTCCTGACTCTGTAAAGAATTACAATGGTGAGCCTCTGTATATCCTGGTTTC
TCTTTGGTGTAAATTGCAGGAGAAATGGATTTCTCGAAATGATATTGCCGAAGCATTCGGTATAAACCTGAGGAGAGCGT
CATTTATTATAACTTATATATCGAGAAGAAAAGAAAAAATTTCATTTCGTGTCAGATATGTCAGTTATGGGAACTTGCAT
TATAAGCGCCTTGAGATTTTTATTTACAATGTTAACCTTGAGGCGGCTCCGACAGAAAGTCATGTATCAACCGGACCGAA
AAGAAAAACCTTACGAGTTGGTAATGGTATTGTGGGACAGTCGAGTATTTGGAACGAAATGATCATGAGACGAAAAAAGG
AGAGTTAG

Protein sequence :
MESKNSDYVIPDSVKNYNGEPLYILVSLWCKLQEKWISRNDIAEAFGINLRRASFIITYISRRKEKISFRVRYVSYGNLH
YKRLEIFIYNVNLEAAPTESHVSTGPKRKTLRVGNGIVGQSSIWNEMIMRRKKES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAL06360.1 unknown Not tested LEE Protein 7e-59 100
Z5128 NP_290277.1 hypothetical protein Not tested LEE Protein 2e-54 92
unnamed AAC38375.1 Orf11 Not tested LEE Protein 3e-54 92
ECs4577 NP_312604.1 hypothetical protein Not tested LEE Protein 2e-54 92
unnamed AAC31522.1 L0043 Not tested LEE Protein 2e-54 92
grlA YP_003232144.1 positive regulator GrlA Not tested LEE Protein 2e-54 92
unnamed ACU09467.1 regulatory protein GrlA Virulence LEE Protein 2e-54 92
grlA YP_003223484.1 positive regulator GrlA Not tested LEE Protein 1e-54 92
unnamed AAK26706.1 unknown Not tested LEE Protein 1e-54 92
grlA YP_003236097.1 positive regulator GrlA Not tested LEE Protein 5e-54 92
unnamed CAI43883.1 hypothetical protein Not tested LEE Protein 4e-54 92
unnamed AAL57533.1 unknown Not tested LEE Protein 4e-54 92
st15 CAC81853.1 ST15 protein Not tested LEE II Protein 4e-54 92
grlA AFO66330.1 putative LEE-encoded positive regulator of transcription Not tested SESS LEE Protein 3e-38 61
grlA AFO66406.1 putative LEE-encoded positive regulator of transcription Virulence SESS LEE Protein 3e-38 61

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
grlA YP_003366511.1 GrlA, global regulator of LEE activator VFG0721 Protein 1e-54 92
grlA YP_003366511.1 GrlA, global regulator of LEE activator VFG0821 Protein 7e-55 92