Gene Information

Name : Geob_3169 (Geob_3169)
Accession : YP_002538613.1
Strain : Geobacter daltonii FRC-32
Genome accession: NC_011979
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3489556 - 3490227 bp
Length : 672 bp
Strand : -
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: gur:Gura_1986 two component heavy metal response transcriptional regulator

DNA sequence :
ATGCGAATACTTGTCATAGAAGATGAAGTGAAAACGGCTGCCTTTATCAGGAAAGGCTTGCGTGAAAGCGGCTACACTGC
CGATGTTGCCAACGAAGGGTTTGAAGGACTGGATCTTGCCCTGACCAGGGAATACGACATTATCATTCTGGATGTGATGC
TCCCGGGGCTGGATGGCTGGCAAATCATCAGCAGGATCCGGAAGCTGAAAAAGGATACCCCCATTATCTTTCTTACGGCA
CGTGATGCGATCCAGGACCGCATAAAGGGGCTTGAACTGGGAGCGGACGATTACCTGGTGAAGCCGTTCGCTTTCTCCGA
ACTGCTTGTTCGCATCCGGACAATCCTCCGGCGCGGGCCGGTGAGGACCCAGGAATTGATAACCATTGGCGATCTGGAGA
TCGACCTCATGGGACACCGTGTGACCCGGGGCGGGAAAAGGCTGGACCTCACCCCTAAAGAATTTGCCCTGATATCCCTC
CTTGCCCGGCGTTCAGGTGAGGTCCTGACCAGGGTGCGCATTGCCGAGCGTATCTGGGATATTGACTTTGAAAGCGATAC
CAACGTGGTTGACGTGCATATGCGCCGTCTTCGGGCGAAGGTGGATGATCCCTTCGAGAAAAAGCTGATCCATACGGTGC
GGGGAGTGGGTTATGTCCTCGAAGAGCGGTAA

Protein sequence :
MRILVIEDEVKTAAFIRKGLRESGYTADVANEGFEGLDLALTREYDIIILDVMLPGLDGWQIISRIRKLKKDTPIIFLTA
RDAIQDRIKGLELGADDYLVKPFAFSELLVRIRTILRRGPVRTQELITIGDLEIDLMGHRVTRGGKRLDLTPKEFALISL
LARRSGEVLTRVRIAERIWDIDFESDTNVVDVHMRRLRAKVDDPFEKKLIHTVRGVGYVLEER

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-58 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-58 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 2e-67 60
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 1e-63 60
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 2e-66 59
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 3e-58 57
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 2e-61 56
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 1e-62 54
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 3e-57 51
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 1e-37 46
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 8e-42 45
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 8e-42 45
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 8e-42 45
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 8e-42 45
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 8e-42 45
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 8e-42 45
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 8e-42 45
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 8e-42 45
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 2e-33 44
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 2e-32 42
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 3e-38 42
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-33 42
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 9e-34 42
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 9e-34 42
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 9e-34 42
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 1e-33 42
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 9e-34 42
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 9e-34 42
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 9e-34 42
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 9e-34 42
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 9e-34 42
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 1e-32 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 6e-59 56
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family VFG1390 Protein 9e-42 44
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 9e-39 44
Geob_3169 YP_002538613.1 two component heavy metal response transcriptional regulator, winged helix family VFG1386 Protein 1e-38 42