Gene Information

Name : irlR (PSTAB_3156)
Accession : YP_004715526.1
Strain : Pseudomonas stutzeri ATCC 17588
Genome accession: NC_015740
Putative virulence/resistance : Virulence
Product : DNA-binding heavy metal response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3373233 - 3373907 bp
Length : 675 bp
Strand : -
Note : -

DNA sequence :
ATGCGAATTCTGGTGGTGGAGGACGAGGCCAAGACGGCCGACTACCTCAAGCGAGGGTTGGAGGAGTCCGGCTACCGGGT
GGAGGTCGCGCGCAACGGCGTCGACGGCAAACACCTGATCGAGGAGGAAACGTTCGATCTGGTAATCCTCGACGTCATGC
TGCCCGGGCTCGATGGCTGGCAGCTGGTGCAGGTGGTGCGCCAGCGTTCGGCGCACACGCCGGTGCTGTTCCTCACCGCC
CGCGATGCGGTGGAAGACCGGGTGCGCGGGCTGGAACTGGGCGCCGACGACTACCTCATCAAACCCTTTTCCTACGCCGA
GCTGCTGGCGCGGGTGAGCACGCTGCTGCGTCGCGGCCCGCCGCGGGAAGTCGAGCATTTCCACGTCGCCGACCTGGAGC
TGGACCTGCTGCGCCGCCGCGTCACCCGTCAGGGCGAGCGCATCAACCTGACCAACAAGGAGTTCGCCTTGCTGCACCTG
CTGCTCAGTCGTCAGGGCGAGGTGCTTTCCCGTGCGCAGATCGCTTCGCAGGTCTGGCAGATGAACTTCGACAGCGACAC
CAATGTGGTCGACGTGGCGATCCGCCGGCTGCGCGCCAAGGTCGACGATCCGTACCCGCTCAAGCTCATCCACACCGTGC
GCGGCATGGGCTACGTGCTGGACATCTCGGCATGA

Protein sequence :
MRILVVEDEAKTADYLKRGLEESGYRVEVARNGVDGKHLIEEETFDLVILDVMLPGLDGWQLVQVVRQRSAHTPVLFLTA
RDAVEDRVRGLELGADDYLIKPFSYAELLARVSTLLRRGPPREVEHFHVADLELDLLRRRVTRQGERINLTNKEFALLHL
LLSRQGEVLSRAQIASQVWQMNFDSDTNVVDVAIRRLRAKVDDPYPLKLIHTVRGMGYVLDISA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-57 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-57 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
irlR YP_004715526.1 DNA-binding heavy metal response regulator BAC0125 Protein 1e-70 66
irlR YP_004715526.1 DNA-binding heavy metal response regulator BAC0197 Protein 7e-69 64
irlR YP_004715526.1 DNA-binding heavy metal response regulator BAC0638 Protein 5e-61 63
irlR YP_004715526.1 DNA-binding heavy metal response regulator BAC0083 Protein 6e-68 62
irlR YP_004715526.1 DNA-binding heavy metal response regulator BAC0308 Protein 2e-63 59
irlR YP_004715526.1 DNA-binding heavy metal response regulator BAC0111 Protein 1e-66 57
irlR YP_004715526.1 DNA-binding heavy metal response regulator BAC0347 Protein 7e-59 54
irlR YP_004715526.1 DNA-binding heavy metal response regulator NC_002952.2859905.p0 Protein 3e-36 45
irlR YP_004715526.1 DNA-binding heavy metal response regulator NC_007622.3794472.p0 Protein 3e-36 45
irlR YP_004715526.1 DNA-binding heavy metal response regulator NC_007793.3914279.p0 Protein 5e-36 45
irlR YP_004715526.1 DNA-binding heavy metal response regulator NC_002951.3237708.p0 Protein 5e-36 45
irlR YP_004715526.1 DNA-binding heavy metal response regulator NC_013450.8614421.p0 Protein 5e-36 45
irlR YP_004715526.1 DNA-binding heavy metal response regulator NC_009782.5559369.p0 Protein 5e-36 45
irlR YP_004715526.1 DNA-binding heavy metal response regulator NC_009641.5332272.p0 Protein 5e-36 45
irlR YP_004715526.1 DNA-binding heavy metal response regulator NC_002745.1124361.p0 Protein 5e-36 45
irlR YP_004715526.1 DNA-binding heavy metal response regulator NC_002758.1121668.p0 Protein 5e-36 45
irlR YP_004715526.1 DNA-binding heavy metal response regulator NC_003923.1003749.p0 Protein 8e-36 45
irlR YP_004715526.1 DNA-binding heavy metal response regulator AE000516.2.gene3505. Protein 8e-28 43
irlR YP_004715526.1 DNA-binding heavy metal response regulator NC_007793.3914065.p0 Protein 8e-37 42
irlR YP_004715526.1 DNA-binding heavy metal response regulator NC_007622.3794948.p0 Protein 8e-37 42
irlR YP_004715526.1 DNA-binding heavy metal response regulator NC_002951.3238224.p0 Protein 8e-37 42
irlR YP_004715526.1 DNA-binding heavy metal response regulator NC_002952.2859858.p0 Protein 8e-37 42
irlR YP_004715526.1 DNA-binding heavy metal response regulator NC_013450.8614146.p0 Protein 8e-37 42
irlR YP_004715526.1 DNA-binding heavy metal response regulator NC_010079.5776364.p0 Protein 8e-37 42
irlR YP_004715526.1 DNA-binding heavy metal response regulator NC_003923.1003417.p0 Protein 8e-37 42
irlR YP_004715526.1 DNA-binding heavy metal response regulator NC_002758.1121390.p0 Protein 8e-37 42
irlR YP_004715526.1 DNA-binding heavy metal response regulator HE999704.1.gene1528. Protein 4e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
irlR YP_004715526.1 DNA-binding heavy metal response regulator VFG0596 Protein 4e-58 56
irlR YP_004715526.1 DNA-binding heavy metal response regulator VFG1389 Protein 3e-35 46
irlR YP_004715526.1 DNA-binding heavy metal response regulator VFG1390 Protein 4e-42 45
irlR YP_004715526.1 DNA-binding heavy metal response regulator VFG1386 Protein 5e-35 42