Gene Information

Name : ST548_p5064 (ST548_p5064)
Accession : YP_007389534.1
Strain : Enterobacter aerogenes EA1509E
Genome accession: NC_020181
Putative virulence/resistance : Virulence
Product : Copper-sensing two-component system response regulator CusR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3314956 - 3315639 bp
Length : 684 bp
Strand : -
Note : -

DNA sequence :
GTGAAGATTTTGATTGTCGAAGATGAGAAGAAAACCGGGGAGTACCTGACCAAAGGGCTTACCGAAGCCGGATTCGTCGT
CGACCTGGCCGACAACGGCCTTAACGGTTATCACCTGGCGATGACCAGCGACTACGATCTGCTGATCCTCGATATCATGC
TGCCGGACGTCAACGGCTGGGATATCGTGCGCATGCTGCGCGCCGCCAATAAAGGGATGCCGATCCTGCTGCTCACCGCG
CTTGGCACTATCGAGCATCGGGTGAAGGGGCTGGAGCTGGGCGCCGACGATTATCTGGTGAAGCCCTTTGCTTTTGCGGA
ACTGCTGGCGCGGGTGCGCACTCTGCTGCGTCGCGGGGCGGCGGTAATAGTAGAAAGCCAGTTTCAGGCGGCCGATCTCA
GCGTTGATTTGGTGAGCCGCAAGGTGACGCGCGGCGCGACTCGTATCACCCTGACCAGCAAAGAGTTTACCCTGCTGGAG
TTCTTCTTGCGCCATCAGGGCGAGGTGCTACCCCGTTCGCTGATCGCGTCGCAGGTGTGGGATATGAATTTCGACAGCGA
CACTAACGCTATCGACGTGGCAGTGAAGCGGCTGCGCGCCAAAATCGATAACGACTTCGAGCCGAAGCTTATCCAGACCG
TGCGCGGCGTCGGCTATATGCTTGAGGTGCCGGATGGCCGCTAA

Protein sequence :
MKILIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAMTSDYDLLILDIMLPDVNGWDIVRMLRAANKGMPILLLTA
LGTIEHRVKGLELGADDYLVKPFAFAELLARVRTLLRRGAAVIVESQFQAADLSVDLVSRKVTRGATRITLTSKEFTLLE
FFLRHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRAKIDNDFEPKLIQTVRGVGYMLEVPDGR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-55 52
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-55 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ST548_p5064 YP_007389534.1 Copper-sensing two-component system response regulator CusR BAC0111 Protein 1e-100 96
ST548_p5064 YP_007389534.1 Copper-sensing two-component system response regulator CusR BAC0347 Protein 3e-87 83
ST548_p5064 YP_007389534.1 Copper-sensing two-component system response regulator CusR BAC0083 Protein 2e-70 63
ST548_p5064 YP_007389534.1 Copper-sensing two-component system response regulator CusR BAC0638 Protein 3e-63 62
ST548_p5064 YP_007389534.1 Copper-sensing two-component system response regulator CusR BAC0308 Protein 5e-63 59
ST548_p5064 YP_007389534.1 Copper-sensing two-component system response regulator CusR BAC0197 Protein 4e-63 59
ST548_p5064 YP_007389534.1 Copper-sensing two-component system response regulator CusR BAC0125 Protein 5e-65 56
ST548_p5064 YP_007389534.1 Copper-sensing two-component system response regulator CusR AE000516.2.gene3505. Protein 4e-27 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ST548_p5064 YP_007389534.1 Copper-sensing two-component system response regulator CusR VFG0596 Protein 8e-56 52
ST548_p5064 YP_007389534.1 Copper-sensing two-component system response regulator CusR VFG1390 Protein 9e-45 45