Gene Information

Name : BTB_c32820 (BTB_c32820)
Accession : YP_006927903.1
Strain : Bacillus thuringiensis Bt407
Genome accession: NC_018877
Putative virulence/resistance : Virulence
Product : Two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3174067 - 3174741 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
ATGCGAGTTCTTATCGTCGAAGATGAACAAGACTTACAAAATATATTGGTGAAACGATTAAATGCAGAACATTATAGTGT
CGATGCATGTGGGAATGGAGAAGATGCCCTAGATTATATAAACATGGCTACCTACGATTTGATTGTCCTTGACATTATGA
TTCCCGGAATAGATGGTTTACGCGTATTACAAAGATTACGCGCGGACAATAATGCAACTCCTATCTTGCTTCTTACAGCT
AAAGATACAATTGATGATCGTGTAACAGGACTCGACTTAGGTGCAGATGATTATTTAGTAAAGCCGTTTGCTTTTGATGA
ACTGTTAGCAAGAATTCGAGTGTTAATGCGAAGAAAAACAGGAAATACATCTAATGTGTTTGAAATCGCTGACCTAGTGG
TAGATTGCAATATGCATAAAGTAACAAGAGGAGACCAAGTTATCACTCTTTCCAGTAAAGAATTTGCTATTTTAGAATAT
ATGATTCGTAATAAAGAAGTTGTGCTGACACGAGATAAAATTGAGCAACATGTGTGGAATTACGACTATGAAGGCGGATC
GAATATTATTGATGTTTACGTCCGCTATCTTCGTAAAAAAATTGATAGCCAGTTTGAAACGAAGTTAATTCATACAGTGC
GCGGAACTGGTTACGTATTGCGAGTAGAATCATGA

Protein sequence :
MRVLIVEDEQDLQNILVKRLNAEHYSVDACGNGEDALDYINMATYDLIVLDIMIPGIDGLRVLQRLRADNNATPILLLTA
KDTIDDRVTGLDLGADDYLVKPFAFDELLARIRVLMRRKTGNTSNVFEIADLVVDCNMHKVTRGDQVITLSSKEFAILEY
MIRNKEVVLTRDKIEQHVWNYDYEGGSNIIDVYVRYLRKKIDSQFETKLIHTVRGTGYVLRVES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-41 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-40 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BTB_c32820 YP_006927903.1 Two-component response regulator BAC0111 Protein 1e-51 50
BTB_c32820 YP_006927903.1 Two-component response regulator BAC0308 Protein 3e-48 48
BTB_c32820 YP_006927903.1 Two-component response regulator BAC0125 Protein 1e-47 48
BTB_c32820 YP_006927903.1 Two-component response regulator BAC0197 Protein 7e-49 48
BTB_c32820 YP_006927903.1 Two-component response regulator BAC0638 Protein 7e-46 48
BTB_c32820 YP_006927903.1 Two-component response regulator BAC0347 Protein 2e-44 47
BTB_c32820 YP_006927903.1 Two-component response regulator BAC0083 Protein 4e-49 46
BTB_c32820 YP_006927903.1 Two-component response regulator NC_007793.3914065.p0 Protein 2e-41 45
BTB_c32820 YP_006927903.1 Two-component response regulator NC_002758.1121390.p0 Protein 2e-41 45
BTB_c32820 YP_006927903.1 Two-component response regulator NC_010079.5776364.p0 Protein 2e-41 45
BTB_c32820 YP_006927903.1 Two-component response regulator NC_002952.2859858.p0 Protein 2e-41 45
BTB_c32820 YP_006927903.1 Two-component response regulator NC_007622.3794948.p0 Protein 2e-41 45
BTB_c32820 YP_006927903.1 Two-component response regulator NC_003923.1003417.p0 Protein 2e-41 45
BTB_c32820 YP_006927903.1 Two-component response regulator NC_013450.8614146.p0 Protein 2e-41 45
BTB_c32820 YP_006927903.1 Two-component response regulator NC_002951.3238224.p0 Protein 2e-41 45
BTB_c32820 YP_006927903.1 Two-component response regulator AE015929.1.gene1106. Protein 1e-36 41
BTB_c32820 YP_006927903.1 Two-component response regulator HE999704.1.gene1528. Protein 3e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BTB_c32820 YP_006927903.1 Two-component response regulator VFG1390 Protein 7e-49 46
BTB_c32820 YP_006927903.1 Two-component response regulator VFG1386 Protein 1e-46 43
BTB_c32820 YP_006927903.1 Two-component response regulator VFG0596 Protein 3e-41 41