Gene Information

Name : Thal_0320 (Thal_0320)
Accession : YP_003473082.1
Strain : Thermocrinis albus DSM 14484
Genome accession: NC_013894
Putative virulence/resistance : Resistance
Product : transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 321147 - 321827 bp
Length : 681 bp
Strand : +
Note : KEGG: mms:mma_2354 heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator; SMART: response regulator receiver

DNA sequence :
ATGCCCAGGATCCTTCTGGTGGAGGACGATCTCTACTTAGGGCAGATGATGGTGGAGGGGCTCAGACACGAAGGATTCAC
TGTGGAATGGGTTCAGGACGGCTTTACTGCCCTCAGGCGTGTGGTGGAAGAGAACTACGATCTTGTAATACTGGACATAA
TGCTTCCTAAGTTTGATGGCATGAAAGTTTGCAGAAAGATAAGAGAAACGAAGGATATACCCGTCATCATGGTCACCGCA
AGGTCGCAGATAGAGGACAAGGTAGAGGGTCTATCTGCGGGGGCAGACGACTACATAACAAAACCCTTCTCCTTCAAGGA
ACTCTCCGCACGCATACAGGCCGTGCTGAGAAGGTACAGGAAAAAAGAAGGGGTGATAATGGTGGGAGATCTGCGCATAG
ATCCCTCTGCGGTAGAGGTTACCTACAGAGGGCAGAAGATACACCTCACCCGTAGAGAGTTTGAACTTCTGAAGCTTCTT
GCCGAAAACGCCAACAGGGTAGTCAGCAGGGAGGAGATATACGCCAAGGTCTGGGGATACTCTCACGAGGAAGGATCCAA
CATAGTGGACGTGTACATAAAGAATCTTAGGAACAAACTGGGGGACAAACCACCACGCCTCATACAGACGGTGAGGGGAT
ACGGTTACATACTGCGTACAGAAGATGTCGGTCAGACTTAA

Protein sequence :
MPRILLVEDDLYLGQMMVEGLRHEGFTVEWVQDGFTALRRVVEENYDLVILDIMLPKFDGMKVCRKIRETKDIPVIMVTA
RSQIEDKVEGLSAGADDYITKPFSFKELSARIQAVLRRYRKKEGVIMVGDLRIDPSAVEVTYRGQKIHLTRREFELLKLL
AENANRVVSREEIYAKVWGYSHEEGSNIVDVYIKNLRNKLGDKPPRLIQTVRGYGYILRTEDVGQT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-35 44
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 7e-33 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-34 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thal_0320 YP_003473082.1 transcriptional regulator NC_007793.3914065.p0 Protein 2e-45 49
Thal_0320 YP_003473082.1 transcriptional regulator NC_007622.3794948.p0 Protein 2e-45 49
Thal_0320 YP_003473082.1 transcriptional regulator NC_002951.3238224.p0 Protein 2e-45 49
Thal_0320 YP_003473082.1 transcriptional regulator NC_002952.2859858.p0 Protein 2e-45 49
Thal_0320 YP_003473082.1 transcriptional regulator NC_013450.8614146.p0 Protein 2e-45 49
Thal_0320 YP_003473082.1 transcriptional regulator NC_010079.5776364.p0 Protein 2e-45 49
Thal_0320 YP_003473082.1 transcriptional regulator NC_003923.1003417.p0 Protein 2e-45 49
Thal_0320 YP_003473082.1 transcriptional regulator NC_002758.1121390.p0 Protein 2e-45 49
Thal_0320 YP_003473082.1 transcriptional regulator AE015929.1.gene1106. Protein 3e-40 48
Thal_0320 YP_003473082.1 transcriptional regulator HE999704.1.gene1528. Protein 3e-35 44
Thal_0320 YP_003473082.1 transcriptional regulator NC_002952.2859905.p0 Protein 3e-36 44
Thal_0320 YP_003473082.1 transcriptional regulator NC_007622.3794472.p0 Protein 3e-36 44
Thal_0320 YP_003473082.1 transcriptional regulator NC_007793.3914279.p0 Protein 4e-36 44
Thal_0320 YP_003473082.1 transcriptional regulator NC_002951.3237708.p0 Protein 4e-36 44
Thal_0320 YP_003473082.1 transcriptional regulator NC_013450.8614421.p0 Protein 4e-36 44
Thal_0320 YP_003473082.1 transcriptional regulator NC_009782.5559369.p0 Protein 4e-36 44
Thal_0320 YP_003473082.1 transcriptional regulator NC_009641.5332272.p0 Protein 4e-36 44
Thal_0320 YP_003473082.1 transcriptional regulator NC_002745.1124361.p0 Protein 4e-36 44
Thal_0320 YP_003473082.1 transcriptional regulator NC_002758.1121668.p0 Protein 4e-36 44
Thal_0320 YP_003473082.1 transcriptional regulator NC_003923.1003749.p0 Protein 4e-36 44
Thal_0320 YP_003473082.1 transcriptional regulator AF155139.2.orf0.gene Protein 1e-34 44
Thal_0320 YP_003473082.1 transcriptional regulator AE000516.2.gene3505. Protein 3e-34 44
Thal_0320 YP_003473082.1 transcriptional regulator BAC0197 Protein 6e-40 43
Thal_0320 YP_003473082.1 transcriptional regulator BAC0125 Protein 3e-34 42
Thal_0320 YP_003473082.1 transcriptional regulator AF310956.2.orf0.gene Protein 3e-33 42
Thal_0320 YP_003473082.1 transcriptional regulator NC_010400.5986590.p0 Protein 2e-32 42
Thal_0320 YP_003473082.1 transcriptional regulator NC_011595.7057856.p0 Protein 5e-32 42
Thal_0320 YP_003473082.1 transcriptional regulator NC_010410.6002989.p0 Protein 5e-32 42
Thal_0320 YP_003473082.1 transcriptional regulator NC_012469.1.7685629. Protein 2e-32 41
Thal_0320 YP_003473082.1 transcriptional regulator AE016830.1.gene2255. Protein 7e-32 41
Thal_0320 YP_003473082.1 transcriptional regulator U35369.1.gene1.p01 Protein 7e-32 41
Thal_0320 YP_003473082.1 transcriptional regulator BAC0308 Protein 1e-35 41
Thal_0320 YP_003473082.1 transcriptional regulator FJ349556.1.orf0.gene Protein 6e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thal_0320 YP_003473082.1 transcriptional regulator VFG0596 Protein 4e-36 44
Thal_0320 YP_003473082.1 transcriptional regulator VFG1389 Protein 7e-37 44
Thal_0320 YP_003473082.1 transcriptional regulator VFG1390 Protein 4e-41 42