Gene Information

Name : Entcl_3253 (Entcl_3253)
Accession : YP_003942783.1
Strain : Enterobacter cloacae SCF1
Genome accession: NC_014618
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3472588 - 3473271 bp
Length : 684 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; KEGG: cko:CKO_02615 DNA-binding transcriptional activator CusR; SMART: response regulator receiver

DNA sequence :
ATGAAAATACTGATTGTCGAAGATGAGGTAAAAACCGGAGAGTACCTCAGCAAGGGGCTGACCGAAGCGGGGTTTGTGGT
CGATCTCGCCGATAACGGCCTGACCGGCTACCACCTGGCAATGACCGCCGATTACGACCTGATCGTACTGGACATCATGC
TGCCCGACGTCAACGGCTGGGATATCGTCCGTATGCTGCGCACCGCCAATAAGGGAATGCCGATTCTGCTGCTGACCGCG
CTCGGCACCATTGAGCATCGGGTGAAGGGGCTTGAGCTCGGCGCCGATGACTATCTGGTGAAGCCGTTCGCCTTCGCCGA
GCTGCTGGCGCGGGTGCGCACTCTGCTGCGCCGCGGGGCGGCGGTGATCCCGGAAAGCCAGTTTCAGGTCGCCGATTTAA
CCCTCGACCTCGTATCGCGTAAGGTGAGCCGCGGCGGCGCCCGTATTACGCTGACCAGCAAAGAGTTTACCCTGCTCGAG
TTTTTTATCCGCCATCGCGGCGAGGTGCTCCCGCGTTCGCTTATCGCCTCGCAGGTCTGGGATATGAACTTTGACAGCGA
CACCAACGCCATCGACGTCGCCGTTAAACGGCTGCGGGCCAAAATCGACAACGATTTTGAGCCGAAGCTGATTCAGACCG
TTCGGGGCGTCGGCTATGTGCTTGAGGTGCCTGATGAGGATTAA

Protein sequence :
MKILIVEDEVKTGEYLSKGLTEAGFVVDLADNGLTGYHLAMTADYDLIVLDIMLPDVNGWDIVRMLRTANKGMPILLLTA
LGTIEHRVKGLELGADDYLVKPFAFAELLARVRTLLRRGAAVIPESQFQVADLTLDLVSRKVSRGGARITLTSKEFTLLE
FFIRHRGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRAKIDNDFEPKLIQTVRGVGYVLEVPDED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-56 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-56 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Entcl_3253 YP_003942783.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 2e-97 92
Entcl_3253 YP_003942783.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 5e-88 83
Entcl_3253 YP_003942783.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 4e-69 60
Entcl_3253 YP_003942783.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 3e-63 60
Entcl_3253 YP_003942783.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 2e-64 60
Entcl_3253 YP_003942783.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 3e-62 60
Entcl_3253 YP_003942783.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 6e-65 57
Entcl_3253 YP_003942783.1 two component heavy metal response transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 4e-28 42
Entcl_3253 YP_003942783.1 two component heavy metal response transcriptional regulator, winged helix family NC_008702.1.4607594. Protein 1e-23 42
Entcl_3253 YP_003942783.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 4e-35 41
Entcl_3253 YP_003942783.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 4e-35 41
Entcl_3253 YP_003942783.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 4e-35 41
Entcl_3253 YP_003942783.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 4e-35 41
Entcl_3253 YP_003942783.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 4e-35 41
Entcl_3253 YP_003942783.1 two component heavy metal response transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 4e-35 41
Entcl_3253 YP_003942783.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 4e-35 41
Entcl_3253 YP_003942783.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 4e-35 41
Entcl_3253 YP_003942783.1 two component heavy metal response transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Entcl_3253 YP_003942783.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 2e-56 54
Entcl_3253 YP_003942783.1 two component heavy metal response transcriptional regulator, winged helix family VFG1390 Protein 1e-44 46
Entcl_3253 YP_003942783.1 two component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 9e-35 42