Gene Information

Name : Shew_3258 (Shew_3258)
Accession : YP_001095383.1
Strain : Shewanella loihica PV-4
Genome accession: NC_009092
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3895743 - 3896459 bp
Length : 717 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: pha:PSHAb0012 transcriptional activator of copper resistance (two-component regulatory system with CusS)

DNA sequence :
ATGCAAATCGGCTTAAACAAGTTAAAGGCTTGCAGGCAAATGCGAATATTAGTGATCGAAGACGAGATCAAGATAGGCGA
CTATCTCAAGAAGGGATTGGAAGAAGCCGGATATACCATCAGCCTGTGTCGCAATGGCTTGGATGGCTATCACTGCGCCA
TCTCTGAACATTTTGATCTTATTATTCTCGATGTGATGCTACCCGACATGAACGGGTGGCAAATCCTCGAAAAAATCCGC
CTCAACAATTCAGATATCCCGGTCATGTTCCTGACCGCGAAGGACAGCCTGGAAGACAAGATCAACGGGCTCGAATCCGG
CGCCGATGACTACCTGGTAAAGCCCTTTGCCTTTGCCGAACTGCTGGCACGTGTAAAAACCCTATTACGCAGAGGCACGA
AACAGCTCCAGTCTGACACCCTAACCCTTCATGGGTTAAAACTGGATATAACAAAACGCCGGGCCAGCCGGGAACAAACG
AAACTGCATCTCACCAATAAGGAGTTTTCCCTACTCGAGTTATTGGTACGCCATCAGGGTGAAGTGCTCACCCGCTCTTT
CATCGCATCTCAGGTATGGGACATGAATTTCGATAGCGACACCAATGTGATCGATGTCGCCATCAGGCGCCTAAGGGCCA
AGGTTGACGATCCCTTCTCGGTAAAGCTTATCCATACCGTACGCGGCATGGGATATAAACTGGACACGGAAGCCTGA

Protein sequence :
MQIGLNKLKACRQMRILVIEDEIKIGDYLKKGLEEAGYTISLCRNGLDGYHCAISEHFDLIILDVMLPDMNGWQILEKIR
LNNSDIPVMFLTAKDSLEDKINGLESGADDYLVKPFAFAELLARVKTLLRRGTKQLQSDTLTLHGLKLDITKRRASREQT
KLHLTNKEFSLLELLVRHQGEVLTRSFIASQVWDMNFDSDTNVIDVAIRRLRAKVDDPFSVKLIHTVRGMGYKLDTEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-56 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-55 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator BAC0638 Protein 3e-61 61
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator BAC0125 Protein 5e-62 59
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator BAC0083 Protein 8e-65 58
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator BAC0111 Protein 5e-67 58
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator BAC0308 Protein 4e-59 58
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator BAC0197 Protein 1e-62 58
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator BAC0347 Protein 5e-61 55
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 1e-34 42
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 1e-34 42
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 1e-34 42
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 1e-34 42
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 1e-34 42
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 1e-34 42
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 1e-34 42
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 1e-34 42
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 4e-33 41
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 3e-33 41
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 3e-33 41
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 3e-33 41
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 4e-33 41
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 3e-33 41
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 3e-33 41
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 3e-33 41
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 3e-33 41
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 3e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator VFG0596 Protein 2e-56 55
Shew_3258 YP_001095383.1 two component heavy metal response transcriptional regulator VFG1389 Protein 3e-37 42