Gene Information

Name : EcolC_3412 (EcolC_3412)
Accession : YP_001726356.1
Strain : Escherichia coli ATCC 8739
Genome accession: NC_010468
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3728906 - 3729586 bp
Length : 681 bp
Strand : -
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: kpn:KPN_pKPN3p05937 transcriptional regulatory protein PcoR

DNA sequence :
ATGCAGCGCATTTTAATCGTTGAAGACGAACAAAAAACAGGTCGTTACCTGCAGCAGGGACTGGTTGAGGAAGGCTATCA
GGCCGATCTCTTTAATAATGGCCGCGATGGTCTCGGGGCCGCGTCGAAGGGACAGTATGATTTGATAATACTGGACGTGA
TGCTGCCTTTCCTCGACGGGTGGCAAATCATCAGCGCACTGAGGGAGTCCGGGCACGAAGAACCGGTCCTGTTTTTAACC
GCAAAGGACAACGTGCGGGACAAAGTGAAAGGACTGGAGCTTGGCGCAGATGACTACCTGATTAAGCCCTTTGATTTTAC
GGAGCTGGTTGCACGTGTAAGAACCCTACTGCGCCGGGCACGCTCGCAGGCCGCAACAGTCTGCACCATCGCCGATATGA
CCGTTGATATGGTGCGCCGGACCGTGATCCGTTCGGGGAAGAAGATCCATCTCACCGGTAAAGAATACGTTCTGCTTGAG
TTGCTGCTGCAACGCACCGGAGAAGTGTTACCCAGGAGTCTTATCTCGTCCCTGGTCTGGAACATGAATTTTGACAGTGA
TACGAATGTGATTGATGTCGCCGTGAGACGTCTGAGAAGTAAAATTGATGATGACTTTGAGCCAAAACTGATCCATACCG
TTCGCGGTGCCGGATATGTCCTGGAGATCAGAGAAGAGTGA

Protein sequence :
MQRILIVEDEQKTGRYLQQGLVEEGYQADLFNNGRDGLGAASKGQYDLIILDVMLPFLDGWQIISALRESGHEEPVLFLT
AKDNVRDKVKGLELGADDYLIKPFDFTELVARVRTLLRRARSQAATVCTIADMTVDMVRRTVIRSGKKIHLTGKEYVLLE
LLLQRTGEVLPRSLISSLVWNMNFDSDTNVIDVAVRRLRSKIDDDFEPKLIHTVRGAGYVLEIREE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-49 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-48 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EcolC_3412 YP_001726356.1 two component heavy metal response transcriptional regulator BAC0308 Protein 1e-95 100
EcolC_3412 YP_001726356.1 two component heavy metal response transcriptional regulator BAC0638 Protein 1e-55 64
EcolC_3412 YP_001726356.1 two component heavy metal response transcriptional regulator BAC0197 Protein 9e-60 63
EcolC_3412 YP_001726356.1 two component heavy metal response transcriptional regulator BAC0083 Protein 4e-59 62
EcolC_3412 YP_001726356.1 two component heavy metal response transcriptional regulator BAC0111 Protein 6e-57 60
EcolC_3412 YP_001726356.1 two component heavy metal response transcriptional regulator BAC0125 Protein 6e-55 58
EcolC_3412 YP_001726356.1 two component heavy metal response transcriptional regulator BAC0347 Protein 1e-49 55
EcolC_3412 YP_001726356.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 2e-30 44
EcolC_3412 YP_001726356.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 2e-30 44
EcolC_3412 YP_001726356.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 2e-30 44
EcolC_3412 YP_001726356.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 2e-30 44
EcolC_3412 YP_001726356.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 2e-30 44
EcolC_3412 YP_001726356.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 2e-30 44
EcolC_3412 YP_001726356.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 2e-30 44
EcolC_3412 YP_001726356.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 2e-30 44
EcolC_3412 YP_001726356.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 2e-25 42
EcolC_3412 YP_001726356.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 2e-31 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EcolC_3412 YP_001726356.1 two component heavy metal response transcriptional regulator VFG0596 Protein 6e-50 55
EcolC_3412 YP_001726356.1 two component heavy metal response transcriptional regulator VFG1390 Protein 6e-35 44
EcolC_3412 YP_001726356.1 two component heavy metal response transcriptional regulator VFG1389 Protein 2e-29 42