Gene Information

Name : EcolC_3426 (EcolC_3426)
Accession : YP_001726370.1
Strain : Escherichia coli ATCC 8739
Genome accession: NC_010468
Putative virulence/resistance : Virulence
Product : DNA-binding transcriptional activator CusR
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3745311 - 3745991 bp
Length : 681 bp
Strand : +
Note : response regulator in two-component regulatory system with CusS; regulates the copper efflux system

DNA sequence :
ATGAAAATATTGATCGTCGAAGACGAAATTAAAACAGGTGAATATCTCAGCAAAGGGCTTACAGGAGCAGGGTTCGTAGT
GGATCACGCTGATAATGGTCTTACCGGATATCATCTCGCCATGACCGCCGAGTATGATTTAGTCATTCTGGATATCATGC
TACCTGATGTGAACGGCTGGGATATCATCCGTATGCTGCGCACTGCCGGAAAGGGTACGCCGGTCTTACTGCTGACGGCC
CTGGGCACGATCGAACACAGGGTCAAAGGACTGGAGCTGGGTGCGGACGATTATCTGGTTAAACCCTTTGCGTTTGCCGA
ACTGCTCGCCCGGGTGAGAACTCTTCTGAGGCGGGGAAACACGATGATCACGGAAAGCCAGTTTAAGGTGGCTGACCTCT
CTATTGATCTCGTATCCAGAAAAGTCAGCCGCGCCGGGAAGCGCATTGTGCTCACCAGTAAAGAGTTCAGCCTGCTGGAA
TTCTTCATTCGCCATCAGGGAGAAGTTCTTCCCCGCTCCCTGATTGCCTCTCAGGTCTGGGACATGAATTTTGACAGCGA
CACTAACGCGATTGATGTCGCAGTAAAGCGACTCCGCGCTAAAATAGACAACGATTACGAGACAAAACTGATCCAGACAG
TGCGGGGCGTGGGCTACATGCTGGAGATCCCGGATGCATAG

Protein sequence :
MKILIVEDEIKTGEYLSKGLTGAGFVVDHADNGLTGYHLAMTAEYDLVILDIMLPDVNGWDIIRMLRTAGKGTPVLLLTA
LGTIEHRVKGLELGADDYLVKPFAFAELLARVRTLLRRGNTMITESQFKVADLSIDLVSRKVSRAGKRIVLTSKEFSLLE
FFIRHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRAKIDNDYETKLIQTVRGVGYMLEIPDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-55 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-55 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EcolC_3426 YP_001726370.1 DNA-binding transcriptional activator CusR BAC0347 Protein 2e-93 93
EcolC_3426 YP_001726370.1 DNA-binding transcriptional activator CusR BAC0111 Protein 2e-94 86
EcolC_3426 YP_001726370.1 DNA-binding transcriptional activator CusR BAC0083 Protein 8e-71 62
EcolC_3426 YP_001726370.1 DNA-binding transcriptional activator CusR BAC0638 Protein 7e-65 62
EcolC_3426 YP_001726370.1 DNA-binding transcriptional activator CusR BAC0197 Protein 3e-65 60
EcolC_3426 YP_001726370.1 DNA-binding transcriptional activator CusR BAC0308 Protein 1e-62 59
EcolC_3426 YP_001726370.1 DNA-binding transcriptional activator CusR BAC0125 Protein 1e-63 56
EcolC_3426 YP_001726370.1 DNA-binding transcriptional activator CusR AE000516.2.gene3505. Protein 1e-27 42
EcolC_3426 YP_001726370.1 DNA-binding transcriptional activator CusR HE999704.1.gene1202. Protein 6e-36 41
EcolC_3426 YP_001726370.1 DNA-binding transcriptional activator CusR NC_007793.3914065.p0 Protein 1e-33 41
EcolC_3426 YP_001726370.1 DNA-binding transcriptional activator CusR NC_007622.3794948.p0 Protein 1e-33 41
EcolC_3426 YP_001726370.1 DNA-binding transcriptional activator CusR NC_002951.3238224.p0 Protein 1e-33 41
EcolC_3426 YP_001726370.1 DNA-binding transcriptional activator CusR NC_002952.2859858.p0 Protein 1e-33 41
EcolC_3426 YP_001726370.1 DNA-binding transcriptional activator CusR NC_013450.8614146.p0 Protein 1e-33 41
EcolC_3426 YP_001726370.1 DNA-binding transcriptional activator CusR NC_010079.5776364.p0 Protein 1e-33 41
EcolC_3426 YP_001726370.1 DNA-binding transcriptional activator CusR NC_003923.1003417.p0 Protein 1e-33 41
EcolC_3426 YP_001726370.1 DNA-binding transcriptional activator CusR NC_002758.1121390.p0 Protein 1e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EcolC_3426 YP_001726370.1 DNA-binding transcriptional activator CusR VFG0596 Protein 5e-56 55
EcolC_3426 YP_001726370.1 DNA-binding transcriptional activator CusR VFG1390 Protein 2e-42 43