Gene Information

Name : Ava_3453 (Ava_3453)
Accession : YP_323955.1
Strain : Anabaena variabilis ATCC 29413
Genome accession: NC_007413
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4283794 - 4284468 bp
Length : 675 bp
Strand : -
Note : -

DNA sequence :
GTGAACGTTCTCTTTGTCGAAGATGAAGCGAAAATTGCTAACTTCGTCCAAGCTGGACTGAAGGAACAGGGGTTTGTCGT
AGACTATTGCGACAACGGTGATGAAGGATATTTGCGGGCATTAGACAACGAATATGATGCCATCATCCTGGATATCATGG
TTCCGGGGAAAGATGGACTATCGATTCTCAAACAACTGCGGCAGAAGGGACGGAATGCACCGGTGATTTTGTTGACGGCT
CGGAATGAGTTAGACGATCGCCTGGCGGGGTTGAATTTGGGTGCTGATGACTACATTGCCAAACCTTTTTTTGTCGAGGA
ACTGGTGGCGCGGATTCATGCTGTGGTGCGCCGGAGTATAGGCGATCGCCAAAATTTGTTGGTGATAGGGACACTCAAGC
TTGATCGCATCACCAGAGAAGTTACTTGCAATCAACGAGTCATCGAACTCACCAGCCGGGAATTTAATCTTTTAGAGTAT
TTAATGCGATCGCCTGGGCGTGTTTTTACCCGTACCCAAATCCTAGAACACGTTTGGGGCTACGACTTTAACCCTAATAC
CAACGTCGTAGATGTTTGTATTCAGCGAATTCGCAAAAAAATTGACCCTGTTGATGAAGCAGGCTGGATTGAAAGTATTC
GCGGCGTGGGTTATCGTTTCCGCCATCCAATATGA

Protein sequence :
MNVLFVEDEAKIANFVQAGLKEQGFVVDYCDNGDEGYLRALDNEYDAIILDIMVPGKDGLSILKQLRQKGRNAPVILLTA
RNELDDRLAGLNLGADDYIAKPFFVEELVARIHAVVRRSIGDRQNLLVIGTLKLDRITREVTCNQRVIELTSREFNLLEY
LMRSPGRVFTRTQILEHVWGYDFNPNTNVVDVCIQRIRKKIDPVDEAGWIESIRGVGYRFRHPI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-38 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-37 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ava_3453 YP_323955.1 two component transcriptional regulator BAC0125 Protein 6e-43 47
Ava_3453 YP_323955.1 two component transcriptional regulator BAC0197 Protein 6e-44 46
Ava_3453 YP_323955.1 two component transcriptional regulator AE015929.1.gene1106. Protein 3e-35 45
Ava_3453 YP_323955.1 two component transcriptional regulator BAC0083 Protein 6e-43 44
Ava_3453 YP_323955.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 5e-37 43
Ava_3453 YP_323955.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 5e-37 43
Ava_3453 YP_323955.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 5e-37 43
Ava_3453 YP_323955.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 5e-37 43
Ava_3453 YP_323955.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 5e-37 43
Ava_3453 YP_323955.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 5e-37 43
Ava_3453 YP_323955.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 5e-37 43
Ava_3453 YP_323955.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 5e-37 43
Ava_3453 YP_323955.1 two component transcriptional regulator BAC0347 Protein 5e-40 43
Ava_3453 YP_323955.1 two component transcriptional regulator BAC0111 Protein 1e-43 43
Ava_3453 YP_323955.1 two component transcriptional regulator BAC0638 Protein 2e-36 42
Ava_3453 YP_323955.1 two component transcriptional regulator BAC0308 Protein 3e-38 42
Ava_3453 YP_323955.1 two component transcriptional regulator AE016830.1.gene1681. Protein 6e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ava_3453 YP_323955.1 two component transcriptional regulator VFG0596 Protein 3e-38 43
Ava_3453 YP_323955.1 two component transcriptional regulator VFG1386 Protein 4e-40 43
Ava_3453 YP_323955.1 two component transcriptional regulator VFG1389 Protein 2e-34 42