Gene Information

Name : czrR (NCGM2_3528)
Accession : YP_005981761.1
Strain : Pseudomonas aeruginosa NCGM2.S1
Genome accession: NC_017549
Putative virulence/resistance : Virulence
Product : putative two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3848863 - 3849537 bp
Length : 675 bp
Strand : +
Note : similar to GI:116050466; similar to PA14_31960 of P. aeruginosa UCBPP-PA14

DNA sequence :
ATGCGCATCCTTATTATCGAAGATGAAGTCAAGACTGCCGACTACCTGCACCAGGGCCTGACCGAAAGCGGCTACATCGT
CGACCGCGCCAACGATGGTATCGACGGCCTGCACATGGCCTTGCAACACCCTTACGAACTGGTGATCCTCGACGTCAACC
TGCCCGGCATCGACGGCTGGGACCTGCTCCGCCGCCTGCGCGAACGCAGCAGCGCGCGGGTGATGATGCTCACCGGGCAT
GGCAGGCTGACCGACAAGGTGCGCGGCCTCGATCTCGGCGCCGACGACTTCATGGTCAAGCCGTTCCAGTTCCCCGAACT
GCTGGCGCGGGTCCGCTCGCTGCTGCGCCGCCACGACCAGGCACCGATGCAGGACGTCCTGCGGGTCGCCGACCTGGAGC
TGGACGCCAGCCGCCACCGGGCCTTCCGCGGCCGGGTGCGGATCAACCTGACGACCAAGGAGTTCGCCCTGCTGCACCTG
CTGATGCGGCGCAACGGCGACGTCATCACCCGGACGCAGATCATCTCGCTGATCTGGGACATGAACTTCGACAACGACTC
CAACGTGGTGGAAGTCGCCATCTGCCGCCTGCGGGCGAAGATCGACGACGGCTTCGACCTCAAGCTGATCCATACCATTC
GCGGCGTCGGCTACGTCCTGGAAGCGCGCCGATGA

Protein sequence :
MRILIIEDEVKTADYLHQGLTESGYIVDRANDGIDGLHMALQHPYELVILDVNLPGIDGWDLLRRLRERSSARVMMLTGH
GRLTDKVRGLDLGADDFMVKPFQFPELLARVRSLLRRHDQAPMQDVLRVADLELDASRHRAFRGRVRINLTTKEFALLHL
LMRRNGDVITRTQIISLIWDMNFDNDSNVVEVAICRLRAKIDDGFDLKLIHTIRGVGYVLEARR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-52 53
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-51 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czrR YP_005981761.1 putative two-component response regulator BAC0197 Protein 8e-60 59
czrR YP_005981761.1 putative two-component response regulator BAC0125 Protein 2e-62 56
czrR YP_005981761.1 putative two-component response regulator BAC0083 Protein 2e-58 56
czrR YP_005981761.1 putative two-component response regulator BAC0638 Protein 4e-53 55
czrR YP_005981761.1 putative two-component response regulator BAC0308 Protein 6e-54 53
czrR YP_005981761.1 putative two-component response regulator BAC0111 Protein 4e-57 50
czrR YP_005981761.1 putative two-component response regulator BAC0347 Protein 3e-53 49
czrR YP_005981761.1 putative two-component response regulator NC_003923.1003417.p0 Protein 3e-36 43
czrR YP_005981761.1 putative two-component response regulator NC_013450.8614146.p0 Protein 3e-36 43
czrR YP_005981761.1 putative two-component response regulator NC_002951.3238224.p0 Protein 3e-36 43
czrR YP_005981761.1 putative two-component response regulator NC_007793.3914065.p0 Protein 3e-36 43
czrR YP_005981761.1 putative two-component response regulator NC_002758.1121390.p0 Protein 3e-36 43
czrR YP_005981761.1 putative two-component response regulator NC_010079.5776364.p0 Protein 3e-36 43
czrR YP_005981761.1 putative two-component response regulator NC_002952.2859858.p0 Protein 3e-36 43
czrR YP_005981761.1 putative two-component response regulator NC_007622.3794948.p0 Protein 3e-36 43
czrR YP_005981761.1 putative two-component response regulator AE015929.1.gene1106. Protein 3e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czrR YP_005981761.1 putative two-component response regulator VFG0596 Protein 3e-52 53