Gene Information

Name : czrR-2 (PSTAA_3538)
Accession : YP_005940140.1
Strain : Pseudomonas stutzeri DSM 4166
Genome accession: NC_017532
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator CzrR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3760205 - 3760879 bp
Length : 675 bp
Strand : -
Note : -

DNA sequence :
ATGCGCATTCTGGTTGTAGAAGACGAGATTAAAGCTGCGGAATACCTGCAGCAGGGTCTCATCGAGTGTGGTTACACGGT
CGATTGCGTAAGTGATGGGCTCGATGGATTCCACCTGGCACTGCAGAACGACTATGACATCGTGCTGCTAGACGTGAATC
TGCCAACCATGGACGGGTGGGAGGTGCTCGAACTCATCAGGCGACGTAAGCAGACACGCGTCATCATGCTGACGGCCAAT
GGCCGCTTAGAGCAAAAGGTCCGCGGCCTGGAGTCGGGCGCCGACGACTATATGGTCAAGCCGTTCCAGTTCCCCGAGCT
GCTCGCTCGTATCCGAACATTGTTGCGGCGAGGCGAGGCGGTCGCACTCCCGAGCAATCTGCGTGTAGCCGACCTCGAAC
TCGACCCGGGCCGGCATCGGGCCTACAGGAGCGGTCAGCGTATTGATCTCACCAGCAAAGAATTTGCGCTACTGCATCTG
CTCATGCGCCGGACTGGCGAGGTTCTCACGCGTACCGAAATAACCGCCCTGGTGTGGGACATCAACTTCGACTGCGATAC
CAATGTGGTGGATGTTGCAATCCGTCGCCTACGGATGAAGGTGGACGAACCCTTTGGCGATCGCCTGATACACACCATTC
GCGGTGTCGGCTACGTGCTGGAGGCGCGGCCTTGA

Protein sequence :
MRILVVEDEIKAAEYLQQGLIECGYTVDCVSDGLDGFHLALQNDYDIVLLDVNLPTMDGWEVLELIRRRKQTRVIMLTAN
GRLEQKVRGLESGADDYMVKPFQFPELLARIRTLLRRGEAVALPSNLRVADLELDPGRHRAYRSGQRIDLTSKEFALLHL
LMRRTGEVLTRTEITALVWDINFDCDTNVVDVAIRRLRMKVDEPFGDRLIHTIRGVGYVLEARP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-56 53
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-55 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czrR-2 YP_005940140.1 DNA-binding response regulator CzrR BAC0125 Protein 5e-63 59
czrR-2 YP_005940140.1 DNA-binding response regulator CzrR BAC0197 Protein 2e-60 57
czrR-2 YP_005940140.1 DNA-binding response regulator CzrR BAC0083 Protein 3e-58 55
czrR-2 YP_005940140.1 DNA-binding response regulator CzrR BAC0638 Protein 8e-54 55
czrR-2 YP_005940140.1 DNA-binding response regulator CzrR BAC0111 Protein 1e-61 54
czrR-2 YP_005940140.1 DNA-binding response regulator CzrR BAC0308 Protein 1e-54 53
czrR-2 YP_005940140.1 DNA-binding response regulator CzrR BAC0347 Protein 2e-58 52
czrR-2 YP_005940140.1 DNA-binding response regulator CzrR NC_007793.3914065.p0 Protein 1e-34 43
czrR-2 YP_005940140.1 DNA-binding response regulator CzrR NC_007622.3794948.p0 Protein 1e-34 43
czrR-2 YP_005940140.1 DNA-binding response regulator CzrR NC_002951.3238224.p0 Protein 1e-34 43
czrR-2 YP_005940140.1 DNA-binding response regulator CzrR NC_002952.2859858.p0 Protein 1e-34 43
czrR-2 YP_005940140.1 DNA-binding response regulator CzrR NC_013450.8614146.p0 Protein 1e-34 43
czrR-2 YP_005940140.1 DNA-binding response regulator CzrR NC_010079.5776364.p0 Protein 1e-34 43
czrR-2 YP_005940140.1 DNA-binding response regulator CzrR NC_003923.1003417.p0 Protein 1e-34 43
czrR-2 YP_005940140.1 DNA-binding response regulator CzrR NC_002758.1121390.p0 Protein 1e-34 43
czrR-2 YP_005940140.1 DNA-binding response regulator CzrR AE015929.1.gene1106. Protein 3e-30 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czrR-2 YP_005940140.1 DNA-binding response regulator CzrR VFG0596 Protein 2e-56 53
czrR-2 YP_005940140.1 DNA-binding response regulator CzrR VFG0473 Protein 8e-29 42
czrR-2 YP_005940140.1 DNA-binding response regulator CzrR VFG1390 Protein 5e-35 42
czrR-2 YP_005940140.1 DNA-binding response regulator CzrR VFG1389 Protein 1e-34 42