Gene Information

Name : Maqu_3740 (Maqu_3740)
Accession : YP_960996.1
Strain : Marinobacter aquaeolei VT8
Genome accession: NC_008740
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4149510 - 4150190 bp
Length : 681 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: hch:HCH_00579 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence : 
GTGAAAGCGCTGGTAATCGAAGACGATCGGGATGTAGCAAATTATCTGCTAAAGGGACTGAGGGAATCCGACTTCGTGGT
GGATCATGCGGCCGACGGCAAGGAAGGCATGATGATGGCGGCCAGTGAAGAATACGACATCATGATTGTCGACCGGATGT
TGCCGGGTATGGATGGCCTTTCCATTATCAAGACGGTACGGGCCACGGGCAACCAGACGCCGGTGCTGATTCTCAGTGCT
CTGGGCGATGTCGATGACCGTGTCGAAGGGCTGCGTGGCGGTGGCGATGACTACCTGACCAAGCCGTTTTCTTTCACCGA
GCTGTTGGCGCGCATCGAGTCACTGATCCGGCGCAACCGTCAGGCGGCCGAGACCGAGACCGTACTGAAAGTGGCGGATC
TGGAGATGGACCTGCTGGCCCGCACCGTAAAACGAGCCGGCCAGAATATTGATGTCCAGCCCCGGGAGTTCAGGCTGCTG
GAATACCTGATGCGTAATGCCGGGCAGGTGGTTACCCGTACCATGCTGCTGGAGAAAGTGTGGGATTATCACTTTGACCC
CCAGACCAACGTGATCGACGTGCATATCAGCCGTCTGCGCGCCAAGATCGACAAGGAATTCGATACACCCCTGCTGCAGA
CAGTGCGGGGGGCGGGATACATGTTACGTGAAACTGCTTAG

Protein sequence : 
MKALVIEDDRDVANYLLKGLRESDFVVDHAADGKEGMMMAASEEYDIMIVDRMLPGMDGLSIIKTVRATGNQTPVLILSA
LGDVDDRVEGLRGGGDDYLTKPFSFTELLARIESLIRRNRQAAETETVLKVADLEMDLLARTVKRAGQNIDVQPREFRLL
EYLMRNAGQVVTRTMLLEKVWDYHFDPQTNVIDVHISRLRAKIDKEFDTPLLQTVRGAGYMLRETA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-45 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-44 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Maqu_3740 YP_960996.1 two component transcriptional regulator BAC0125 Protein 1e-52 52
Maqu_3740 YP_960996.1 two component transcriptional regulator BAC0347 Protein 2e-53 51
Maqu_3740 YP_960996.1 two component transcriptional regulator BAC0638 Protein 2e-47 50
Maqu_3740 YP_960996.1 two component transcriptional regulator BAC0083 Protein 6e-54 49
Maqu_3740 YP_960996.1 two component transcriptional regulator BAC0111 Protein 2e-55 48
Maqu_3740 YP_960996.1 two component transcriptional regulator BAC0197 Protein 3e-47 46
Maqu_3740 YP_960996.1 two component transcriptional regulator BAC0308 Protein 8e-49 45
Maqu_3740 YP_960996.1 two component transcriptional regulator HE999704.1.gene1528. Protein 7e-33 41
Maqu_3740 YP_960996.1 two component transcriptional regulator AE016830.1.gene1681. Protein 2e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Maqu_3740 YP_960996.1 two component transcriptional regulator VFG0596 Protein 1e-45 44
Maqu_3740 YP_960996.1 two component transcriptional regulator VFG1389 Protein 2e-38 43
Maqu_3740 YP_960996.1 two component transcriptional regulator VFG1390 Protein 1e-43 41