Gene Information

Name : Cpin_3739 (Cpin_3739)
Accession : YP_003123402.1
Strain : Chitinophaga pinensis DSM 2588
Genome accession: NC_013132
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4699614 - 4700414 bp
Length : 801 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: two component heavy metal response transcriptional regulator, winged helix family; K07665 two-component system, OmpR family, copper resi

DNA sequence :
ATGAAGCAATTCCTAATTCCTAATTCTTTAAAAGGGACAGCTTTTACGATAGCCCCTACAACCGATACTGAAAGCAAACT
CGTATCTTCAGGCCGGAGAAATATATATAATATTATGCAGCGCATACTCGTAGTTGAAGACGAAATCAAAGTGGCTAATA
CCGTAAAAAAGGGATTGGAAGAGAATGGCTTTGAAGTAGACGTCGCCTATGACGGCCGCATGGGTAAAAGCCTGGCTGCC
AGCAATAACTACGACCTGGTCATCCTGGACCTCAACCTCCCCCATGCTAACGGATACGAAGTATGCGAAGTGATCCGCCG
TAAAAATAATGCGATCCCCATCATCATGCTTACCGCCCTGGGTGGTATGGATGATAAGATGCAGGCATTCGAACTGGGCG
CTGACGATTACCTGGTAAAACCTTTCGACTTCAGAGAACTCATGGCCCGTATTAGGGTGTTCCTCAAACGCGCCGGTTCC
GAAGTACAGGAAAACAACCAGTATAAGATCGTTATCGGCGACCTGGAAATTGACCGTGAGAAGAAAGAAGTAACGCGTGG
TGGCAAAAAGATCGCCCTCACCGCCAAAGAATATCAGCTGCTGGAATTCCTGGCACTCCATAAAGGAAAGGTGATCTCCA
AACTGGTCATTGCCGAAAAAGTATGGGACATCGACTTCGATACCGGTACCAACGTCATCGAAGTATATATGAACTTCCTC
CGGAAGAAGATCGACAAAGATTTTGATAATAAGCTCCTGCATACAAAAACAGGAATGGGATATTACCTGGCCGAAGAGTG
A

Protein sequence :
MKQFLIPNSLKGTAFTIAPTTDTESKLVSSGRRNIYNIMQRILVVEDEIKVANTVKKGLEENGFEVDVAYDGRMGKSLAA
SNNYDLVILDLNLPHANGYEVCEVIRRKNNAIPIIMLTALGGMDDKMQAFELGADDYLVKPFDFRELMARIRVFLKRAGS
EVQENNQYKIVIGDLEIDREKKEVTRGGKKIALTAKEYQLLEFLALHKGKVISKLVIAEKVWDIDFDTGTNVIEVYMNFL
RKKIDKDFDNKLLHTKTGMGYYLAEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-40 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-39 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cpin_3739 YP_003123402.1 winged helix family two component transcriptional regulator BAC0083 Protein 7e-46 49
Cpin_3739 YP_003123402.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-45 47
Cpin_3739 YP_003123402.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-49 47
Cpin_3739 YP_003123402.1 winged helix family two component transcriptional regulator BAC0308 Protein 3e-45 46
Cpin_3739 YP_003123402.1 winged helix family two component transcriptional regulator BAC0638 Protein 7e-40 46
Cpin_3739 YP_003123402.1 winged helix family two component transcriptional regulator BAC0347 Protein 6e-44 44
Cpin_3739 YP_003123402.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-40 44
Cpin_3739 YP_003123402.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-33 41
Cpin_3739 YP_003123402.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-33 41
Cpin_3739 YP_003123402.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-33 41
Cpin_3739 YP_003123402.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-33 41
Cpin_3739 YP_003123402.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-33 41
Cpin_3739 YP_003123402.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-33 41
Cpin_3739 YP_003123402.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-33 41
Cpin_3739 YP_003123402.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-33 41
Cpin_3739 YP_003123402.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cpin_3739 YP_003123402.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-40 42