Gene Information

Name : PSPA7_3892 (PSPA7_3892)
Accession : YP_001349246.1
Strain : Pseudomonas aeruginosa PA7
Genome accession: NC_009656
Putative virulence/resistance : Virulence
Product : putative two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4023732 - 4024421 bp
Length : 690 bp
Strand : -
Note : Annotation generated by automatically transferring the annotation from the manually curated GenBank accession AE004091; identified by match to protein family HMM PF00072; match to protein family HMM PF00486; match to protein family HMM TIGR01387

DNA sequence :
ATGCGGGTACTGATAGTCGAGGACGAGGCGAAGACGGCGGACTACCTGAACCGCGGCCTGACCGAGCAGGGTTTCACCGT
GGACCTGGCGGACAATGGCATCGATGGCCGCCACCTGGCGCTCAACGGCGAGTACGACGTGATCGTGCTCGACGTGATGC
TGCCCGGGATCGACGGCTACGGCGTGCTGCGGGCGCTGCGCGAGCAGCGGCAGACACCGGTGATCATGCTCACCGCGCGC
GAGCGGGTGGAGGACCGCGTGCGGGGCCTGCGCGAGGGCGCCGACGACTATCTGATCAAGCCGTTTTCCTTCCTCGAACT
GGTCGCTCGCCTGCAGGCCCTGACCCGACGCGGCGGCAACCACGAAAGCGCGTCGCAGATGCGCGTCGCCGACCTGTCCA
TCGACCTGCTCAGCCGCAAGGTGTTCCGCGGCGGCAGCCGCCTGGAACTGACCGCCAAGGAATACGCGCTGCTCTGCGTG
CTGGCCCAGCGCAGCGGCGAGATCCTGTCGAAGACGGCGATCGCCGAGCTGGTCTGGGACATCAATTTCGACACCGACAC
GAATGTCGTCGAGGTCGCGATCAAGCGCCTGCGGGCCAAGCTCGACGGGCCCTTCGAGAACAAGCTGCTGCATACCATCC
GGGGCATGGGCTATGTGCTGGAGAACCGCGCGCTGGCGGAGCCGGGCTGA

Protein sequence :
MRVLIVEDEAKTADYLNRGLTEQGFTVDLADNGIDGRHLALNGEYDVIVLDVMLPGIDGYGVLRALREQRQTPVIMLTAR
ERVEDRVRGLREGADDYLIKPFSFLELVARLQALTRRGGNHESASQMRVADLSIDLLSRKVFRGGSRLELTAKEYALLCV
LAQRSGEILSKTAIAELVWDINFDTDTNVVEVAIKRLRAKLDGPFENKLLHTIRGMGYVLENRALAEPG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-54 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-53 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PSPA7_3892 YP_001349246.1 putative two-component response regulator BAC0125 Protein 7e-65 59
PSPA7_3892 YP_001349246.1 putative two-component response regulator BAC0197 Protein 5e-61 57
PSPA7_3892 YP_001349246.1 putative two-component response regulator BAC0083 Protein 1e-58 57
PSPA7_3892 YP_001349246.1 putative two-component response regulator BAC0638 Protein 1e-55 57
PSPA7_3892 YP_001349246.1 putative two-component response regulator BAC0111 Protein 2e-61 55
PSPA7_3892 YP_001349246.1 putative two-component response regulator BAC0308 Protein 1e-56 54
PSPA7_3892 YP_001349246.1 putative two-component response regulator BAC0347 Protein 3e-56 53
PSPA7_3892 YP_001349246.1 putative two-component response regulator NC_013450.8614146.p0 Protein 6e-36 42
PSPA7_3892 YP_001349246.1 putative two-component response regulator NC_002951.3238224.p0 Protein 6e-36 42
PSPA7_3892 YP_001349246.1 putative two-component response regulator NC_007793.3914065.p0 Protein 6e-36 42
PSPA7_3892 YP_001349246.1 putative two-component response regulator NC_002758.1121390.p0 Protein 6e-36 42
PSPA7_3892 YP_001349246.1 putative two-component response regulator NC_010079.5776364.p0 Protein 6e-36 42
PSPA7_3892 YP_001349246.1 putative two-component response regulator NC_002952.2859858.p0 Protein 6e-36 42
PSPA7_3892 YP_001349246.1 putative two-component response regulator NC_007622.3794948.p0 Protein 6e-36 42
PSPA7_3892 YP_001349246.1 putative two-component response regulator NC_003923.1003417.p0 Protein 6e-36 42
PSPA7_3892 YP_001349246.1 putative two-component response regulator AE015929.1.gene1106. Protein 8e-32 41
PSPA7_3892 YP_001349246.1 putative two-component response regulator HE999704.1.gene1528. Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PSPA7_3892 YP_001349246.1 putative two-component response regulator VFG0596 Protein 6e-55 54
PSPA7_3892 YP_001349246.1 putative two-component response regulator VFG1389 Protein 3e-37 45
PSPA7_3892 YP_001349246.1 putative two-component response regulator VFG1390 Protein 1e-38 43
PSPA7_3892 YP_001349246.1 putative two-component response regulator VFG1386 Protein 6e-36 42