Gene Information

Name : BAMF_3852 (BAMF_3852)
Accession : YP_003922448.1
Strain : Bacillus amyloliquefaciens DSM 7
Genome accession: NC_014551
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3913916 - 3914599 bp
Length : 684 bp
Strand : -
Note : Transcriptional regulatory protein yycF;, Signal transduction response regulator, receiver region, Response regulator receiver domain, PhoB: phosphate regulon transcriptional regulatory protein PhoB

DNA sequence :
ATGGATAAGTTGAAAGGCATCAAGGTGCTGATTGTAGACGATGAGCCGGCGATCATTGATTTTTTAACGATGGGGCTTGT
CAATGAAGGATTTGAAGTGATGTCCGCGGCAGACGGGATGTCGGCAATGAATCTTGTTAAAACATTTCAGCCTCATATTG
CTGTTTTGGACGTTATGATGCCGGGAATGGATGGGCTTGAGCTGTCAAGAATGCTCAAGAAAACAAGCAATACCGCCGTC
ATTATGCTGACCGCGAAGGATGAAGTAGAGCTCCGCGTAAAGGCGCTGATTGAAGGGGCTGATGATTACATGATCAAACC
GTTCAGCTTTGAGGAGCTGCTTGCCCGGATTTACGCAAGAATCCGCAACCAGTTTCCGCATCTTTTTGATGAGGTGGTGC
TCGGCCCTTTCCGAATCGATGACCGGAGCAGAGAGATTCATTACAATGAACAGCCTTTGAAGCTGTCTGCCACCGAATAT
GAACTGCTGAAATTTTTAGTGCTTCGCCACGGGACGGTGCTCAGTAAAACGAGGATTCTCGATCAAGTATGGGGCTATGA
TTTTTACGGGGAAGACAATATCGTCGAGGTGTACATCCGTTCTTTACGCGAAAAGCTGAAAGACAAAGAGCATAAAGTGA
TCCGCACGGTGCGGGGCGCGGGGTACAGGGTGGATCTGGCATGA

Protein sequence :
MDKLKGIKVLIVDDEPAIIDFLTMGLVNEGFEVMSAADGMSAMNLVKTFQPHIAVLDVMMPGMDGLELSRMLKKTSNTAV
IMLTAKDEVELRVKALIEGADDYMIKPFSFEELLARIYARIRNQFPHLFDEVVLGPFRIDDRSREIHYNEQPLKLSATEY
ELLKFLVLRHGTVLSKTRILDQVWGYDFYGEDNIVEVYIRSLREKLKDKEHKVIRTVRGAGYRVDLA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BAMF_3852 YP_003922448.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 2e-35 41
BAMF_3852 YP_003922448.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-35 41
BAMF_3852 YP_003922448.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-35 41
BAMF_3852 YP_003922448.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-35 41
BAMF_3852 YP_003922448.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-35 41
BAMF_3852 YP_003922448.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-35 41
BAMF_3852 YP_003922448.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-35 41
BAMF_3852 YP_003922448.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-35 41
BAMF_3852 YP_003922448.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-35 41
BAMF_3852 YP_003922448.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 2e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BAMF_3852 YP_003922448.1 two component transcriptional regulator, winged helix family VFG0596 Protein 7e-39 41
BAMF_3852 YP_003922448.1 two component transcriptional regulator, winged helix family VFG1390 Protein 6e-36 41