Gene Information

Name : LL3_04176 (LL3_04176)
Accession : YP_005547927.1
Strain : Bacillus amyloliquefaciens LL3
Genome accession: NC_017190
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3928936 - 3929619 bp
Length : 684 bp
Strand : -
Note : -

DNA sequence :
ATGGATAAGTTGAAAGGCATCAAGGTGCTGATTGTAGACGATGAGCCGGCGATCATTGATTTTTTAACGATGGGGCTTGT
CAATGAAGGATTTGAAGTGATGTCCGCGGCAGACGGGATGTCGGCAATGAATCTTGTTAAAACATTTCAGCCTCATATTG
CTGTTTTGGACGTTATGATGCCGGGAATGGATGGGCTTGAGCTGTCAAGAATGCTCAAGAAAACAAGCAATACCGCCGTC
ATTATGCTGACCGCGAAGGATGAAGTAGAGCTCCGCGTAAAGGCGCTGATTGAAGGGGCTGATGATTACATGATCAAACC
GTTCAGCTTTGAGGAGCTGCTTGCCCGGATTTACGCAAGAATCCGCAACCAGTTTCCGCATCTTTTTGATGAGGTGGTGC
TCGGCCCTTTCCGAATCGATGACCGGAGCAGAGAGATTCATTACAATGAACAGCCTTTGAAGCTGTCTGCCACCGAATAT
GAACTGCTGAAATTTTTAGTGCTTCGCCACGGGACGGTGCTCAGTAAAACGAGGATTCTCGATCAAGTATGGGGCTATGA
TTTTTACGGGGAAGACAATATCGTCGAGGTGTACATCCGTTCTTTACGCGAAAAGCTGAAAGACAAAGAGCATAAAGTGA
TCCGCACGGTGCGGGGCGCGGGGTACAGGGTGGATCTGGCATGA

Protein sequence :
MDKLKGIKVLIVDDEPAIIDFLTMGLVNEGFEVMSAADGMSAMNLVKTFQPHIAVLDVMMPGMDGLELSRMLKKTSNTAV
IMLTAKDEVELRVKALIEGADDYMIKPFSFEELLARIYARIRNQFPHLFDEVVLGPFRIDDRSREIHYNEQPLKLSATEY
ELLKFLVLRHGTVLSKTRILDQVWGYDFYGEDNIVEVYIRSLREKLKDKEHKVIRTVRGAGYRVDLA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LL3_04176 YP_005547927.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-35 41
LL3_04176 YP_005547927.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-35 41
LL3_04176 YP_005547927.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-35 41
LL3_04176 YP_005547927.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-35 41
LL3_04176 YP_005547927.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-35 41
LL3_04176 YP_005547927.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-35 41
LL3_04176 YP_005547927.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-35 41
LL3_04176 YP_005547927.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-35 41
LL3_04176 YP_005547927.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-35 41
LL3_04176 YP_005547927.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LL3_04176 YP_005547927.1 winged helix family two component transcriptional regulator VFG0596 Protein 7e-39 41
LL3_04176 YP_005547927.1 winged helix family two component transcriptional regulator VFG1390 Protein 6e-36 41