Gene Information

Name : PPS_4210 (PPS_4210)
Accession : YP_004703629.1
Strain : Pseudomonas putida S16
Genome accession: NC_015733
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4774422 - 4775096 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
ATGCGTCTACTGATCATCGAGGACGAACTGCGCACCGCCGACTACCTGCAGCAGGGCCTGCGCGAGAACGGCTACGTGGT
CGACTGCGCCCACACCGGCACCGATGGCCTGCACCTGGCCCGCCAGCAGCCCTACGACCTGGTCATCCTCGACGTCAACC
TGCCCGAGCTCGATGGCTGGACCGTGCTGCAGCGGCTGCGCGCCGAATCGGCCACGCGCATCATGATGCTGACCGCCCAT
GGCCGCCTGGCCGACCGGGTCAAGGGCCTGGACCTGGGTGCCGACGATTACCTGCTCAAGCCCTTCGAGTTTCCGGAACT
GCTCGCCCGTATCCGCAGCCTGCTGCGCCGCAACGACCAGCAACTGCAGCCCAGCACCCTGCGCGTTGCAGATCTGGAGC
TGGACCCCGGCCGCCACCGTGCCTACCGCGCCGGGCAGCGTATCGACCTGACCGCCAAGGAATTCGCCCTGCTGCACCTG
CTGATGCGTCAGACCGGCGAGGTGCTGTCGCGCACCCAGATCATCTCGCTGGTGTGGGACATGAATTTCGACTGCGACAC
CAATGTGGTCGAGGTTTCGATCCGGCGCCTGCGGGCCAAGATCGACGACCCGTTCGACAACAAGCTGATCCATACCCTGC
GTGGCGTCGGCTACGTGCTCGAGGCACGCTTTTGA

Protein sequence :
MRLLIIEDELRTADYLQQGLRENGYVVDCAHTGTDGLHLARQQPYDLVILDVNLPELDGWTVLQRLRAESATRIMMLTAH
GRLADRVKGLDLGADDYLLKPFEFPELLARIRSLLRRNDQQLQPSTLRVADLELDPGRHRAYRAGQRIDLTAKEFALLHL
LMRQTGEVLSRTQIISLVWDMNFDCDTNVVEVSIRRLRAKIDDPFDNKLIHTLRGVGYVLEARF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-56 53
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-55 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator BAC0083 Protein 7e-62 60
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator BAC0125 Protein 8e-66 60
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator BAC0197 Protein 4e-64 59
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator BAC0638 Protein 1e-55 59
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator BAC0308 Protein 1e-57 56
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator BAC0111 Protein 3e-61 55
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator BAC0347 Protein 2e-57 51
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 2e-37 43
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 2e-37 43
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 2e-37 43
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 2e-37 43
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 2e-37 43
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 2e-37 43
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 2e-37 43
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 2e-37 43
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 1e-32 42
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator U82965.2.orf14.gene. Protein 2e-33 42
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 6e-29 42
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator CP001918.1.gene5135. Protein 6e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator VFG0596 Protein 2e-56 53
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator VFG1389 Protein 1e-36 44
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator VFG1390 Protein 3e-38 43
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator VFG1386 Protein 3e-38 43
PPS_4210 YP_004703629.1 two component heavy metal response transcriptional regulator VFG0473 Protein 1e-30 41