Gene Information

Name : DSY4317 (DSY4317)
Accession : YP_520550.1
Strain : Desulfitobacterium hafniense Y51
Genome accession: NC_007907
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4914497 - 4915180 bp
Length : 684 bp
Strand : -
Note : similarity to COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain(Evalue: 9E-49)

DNA sequence :
ATGCAAAAATTGAAAGGAATCAAAATCCTGATTATTGATGATGAACCGAACATTCTGGAGTTCCTGGAAATGGGGCTGCT
GAACGAGGGCTTTGAGGTGCAGACGGCGGCTGATGGGATGACAGGAGTTACCTTGGCTAAACAGCTCCATCCCCACCTTG
TGATTCTGGATATTATGATGCCGGGAATGGATGGCTTTGAAGTCTGCCGGATGCTGAAGAAGAGTGAGAATGTGTCCATT
ATTATGCTGACCGCTAAGGATGAAGTGGAGGACCGGGTCAAGGGTTTAACCATCGGCGCTGACGATTATATGGCTAAGCC
TTTTAGCTTTGAGGAACTCCTTGCCCGCATTCACGCCCGTATCCGCAATCAATTCCCCACCCTTTTAGGAGAAGTGGTGA
TGGGCCCCTTTCGTTTGGATGATCGCCGCAAGGAAATCCAGTTTCAGGATAAGGTTCTGGAGCTTTCCCCTACAGAGTAT
GAGTTGCTCAAATTTTTAATTCTTAATCAGGGGCTGGTTTTGAGCAAGACGATGATTTTAGATAAAGTGTGGGGATATGA
TTTTGCTGGTGATGATAATATCGTGGAGGTCTACATTCGCTCCTTGAGAGAAAAACTGGGGGATAAGGAGCACCGGCTGA
TTCGTACACTGCGGGGCTCCGGGTATCGGATGGACCTGATATGA

Protein sequence :
MQKLKGIKILIIDDEPNILEFLEMGLLNEGFEVQTAADGMTGVTLAKQLHPHLVILDIMMPGMDGFEVCRMLKKSENVSI
IMLTAKDEVEDRVKGLTIGADDYMAKPFSFEELLARIHARIRNQFPTLLGEVVMGPFRLDDRRKEIQFQDKVLELSPTEY
ELLKFLILNQGLVLSKTMILDKVWGYDFAGDDNIVEVYIRSLREKLGDKEHRLIRTLRGSGYRMDLI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-39 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DSY4317 YP_520550.1 hypothetical protein NC_003923.1003749.p0 Protein 3e-37 44
DSY4317 YP_520550.1 hypothetical protein HE999704.1.gene2815. Protein 1e-37 44
DSY4317 YP_520550.1 hypothetical protein NC_002952.2859905.p0 Protein 2e-37 43
DSY4317 YP_520550.1 hypothetical protein NC_007622.3794472.p0 Protein 3e-37 43
DSY4317 YP_520550.1 hypothetical protein NC_007793.3914279.p0 Protein 3e-37 43
DSY4317 YP_520550.1 hypothetical protein NC_002951.3237708.p0 Protein 3e-37 43
DSY4317 YP_520550.1 hypothetical protein NC_013450.8614421.p0 Protein 3e-37 43
DSY4317 YP_520550.1 hypothetical protein NC_009782.5559369.p0 Protein 3e-37 43
DSY4317 YP_520550.1 hypothetical protein NC_009641.5332272.p0 Protein 3e-37 43
DSY4317 YP_520550.1 hypothetical protein NC_002745.1124361.p0 Protein 3e-37 43
DSY4317 YP_520550.1 hypothetical protein NC_002758.1121668.p0 Protein 3e-37 43
DSY4317 YP_520550.1 hypothetical protein NC_007793.3914065.p0 Protein 3e-35 41
DSY4317 YP_520550.1 hypothetical protein NC_007622.3794948.p0 Protein 3e-35 41
DSY4317 YP_520550.1 hypothetical protein NC_002951.3238224.p0 Protein 3e-35 41
DSY4317 YP_520550.1 hypothetical protein NC_002952.2859858.p0 Protein 3e-35 41
DSY4317 YP_520550.1 hypothetical protein NC_013450.8614146.p0 Protein 3e-35 41
DSY4317 YP_520550.1 hypothetical protein NC_010079.5776364.p0 Protein 3e-35 41
DSY4317 YP_520550.1 hypothetical protein NC_003923.1003417.p0 Protein 3e-35 41
DSY4317 YP_520550.1 hypothetical protein NC_002758.1121390.p0 Protein 3e-35 41
DSY4317 YP_520550.1 hypothetical protein AE015929.1.gene1106. Protein 5e-30 41
DSY4317 YP_520550.1 hypothetical protein BAC0083 Protein 1e-34 41
DSY4317 YP_520550.1 hypothetical protein BAC0638 Protein 4e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DSY4317 YP_520550.1 hypothetical protein VFG1386 Protein 2e-39 45
DSY4317 YP_520550.1 hypothetical protein VFG0596 Protein 3e-39 42
DSY4317 YP_520550.1 hypothetical protein VFG1390 Protein 1e-36 42
DSY4317 YP_520550.1 hypothetical protein VFG1389 Protein 2e-32 41