Gene Information

Name : Tsac_0443 (Tsac_0443)
Accession : YP_006391072.1
Strain : Thermoanaerobacterium saccharolyticum JW/SL-YS485
Genome accession: NC_017992
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 474685 - 475380 bp
Length : 696 bp
Strand : -
Note : KEGG: txy:Thexy_2336 two component transcriptional regulator, winged helix family; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver r

DNA sequence :
TTGAGCAGAATCCTGATAGTAGACGACGAAAAGCCAATTGTGGAGATTTTGAAGTACAATTTAGAAAAAAACGGGTACAG
CACGATAGAGGCATACGATGGGGAGGAAGGTCTTAAGATGGCGCAAGAAAAGAATCCTGACCTTATCCTCCTTGACGTCA
TGCTTCCAAAAATGGACGGTTTTACAGTTTTAAGGATATTGAGGCAGACTATGACTACACCCATATTGATGCTTACGGCA
AAGGAAGAGGAAGTAGACAAAGTGTTAGGATTGGAACTGGGTGCTGACGACTATGTGACGAAACCTTTTTCTATGAGGGA
GCTTATTGCCAGGGTGAAAGCCAACTTAAGAAGGAGCGGCATAAGCAATGGTGAAACCATGTCAAATGTTTTAAGCGTAA
ACAATTTGAATATCGATTTGTCAAAGTACAGAGTAGAAAAAAACGGAAAACCTATCGAGCTTACATCGAGAGAATTTGAC
CTGTTAAAGTTTTTGGTGGCCAACCGAGGGCTTATATTTTCACGGGAGATGCTTTTAGAAAAAGTTTGGGGCTATGAATA
CTTTGGCGATGTAAGGACGGTGGATGTGACAATAAGGCGACTTAGGGAAAAAATTGAGGACGATCCGGCAAACCCAAGGT
ATATACATACCAAAAGAGGGGTTGGTTATTATTTTAGCGAAGAAAGTGAACTATAA

Protein sequence :
MSRILIVDDEKPIVEILKYNLEKNGYSTIEAYDGEEGLKMAQEKNPDLILLDVMLPKMDGFTVLRILRQTMTTPILMLTA
KEEEVDKVLGLELGADDYVTKPFSMRELIARVKANLRRSGISNGETMSNVLSVNNLNIDLSKYRVEKNGKPIELTSREFD
LLKFLVANRGLIFSREMLLEKVWGYEYFGDVRTVDVTIRRLREKIEDDPANPRYIHTKRGVGYYFSEESEL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-38 43
sboR YP_006309915.1 SboR Not tested FWisland_1 Protein 5e-33 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-61 54
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-52 51
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-52 51
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-52 51
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-52 51
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-52 51
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-52 51
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-52 51
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-52 51
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-52 51
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-52 51
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-51 49
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 6e-46 48
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-48 47
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 6e-43 47
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-40 45
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-39 45
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-36 44
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 5e-40 44
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 5e-40 44
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-39 44
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-37 43
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-37 43
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-37 43
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-37 43
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-37 43
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-37 43
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-37 43
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-37 43
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-31 43
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 7e-40 43
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator BAC0308 Protein 9e-36 42
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 4e-31 42
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 4e-31 42
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-40 42
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 3e-40 42
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 1e-36 42
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 3e-35 41
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 4e-31 41
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 2e-35 41
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator BAC0111 Protein 4e-36 41
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator BAC0533 Protein 6e-31 41
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 2e-37 41
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 6e-31 41
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 8e-26 41
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 4e-39 41
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 2e-33 41
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 7e-34 41
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator BAC0039 Protein 7e-34 41
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 7e-34 41
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator BAC0596 Protein 7e-34 41
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 6e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-35 45
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator VFG1386 Protein 3e-42 44
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-38 43
Tsac_0443 YP_006391072.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-37 42