Gene Information

Name : PputGB1_4369 (PputGB1_4369)
Accession : YP_001670593.1
Strain : Pseudomonas putida GB-1
Genome accession: NC_010322
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4893872 - 4894546 bp
Length : 675 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: pen:PSEEN4285 heavy-metal DNA-binding response regulator CzrR

DNA sequence :
ATGCGCCTACTGATCATCGAGGACGAGCTGCGAACCGCCGACTATTTGCAACAAGGCCTGCGCGAGAACGGCTATGTGGT
CGACTGCGCCCACACTGGCACCGATGGCCTGCACCTGGCCCGTCAACAGCCCTATGAGCTGGTCATTCTCGACGTCAACC
TGCCTGAACTCGATGGCTGGACCGTGCTGCAACGCCTGCGCGCCGAGTCGGCAACGCGCATCATGATGCTTACCGCCCAC
GGCCGCCTGGCCGACCGGGTCAAAGGCCTGGACCTGGGCGCCGACGACTACCTGCTCAAACCCTTCGAGTTCCCTGAGCT
GTTGGCGCGCATCCGCAGCCTGCTGCGCCGCAACGACCAGCAACTGCAGCCCAGCACCCTGCGGGTCGCCGACCTGGAAC
TGGACCCCGGCCGCCACCGCGCTTACCGCGCCGGACAGCGCATCGACCTGACCGCCAAGGAGTTCGCCCTGCTGCACCTG
CTGATGCGCCAGACAGGCGAAGTGCTGTCGCGCACGCAGATCATTTCGCTGGTGTGGGACATGAACTTCGACTGCGACAC
CAACGTGGTCGAGGTCTCGATCCGGCGCCTGCGGGCCAAGATCGACGACCCGTTCGATAACAAGCTGATTCACACCCTGC
GTGGCGTGGGCTATGTACTTGAGGCGCGCTTTTGA

Protein sequence :
MRLLIIEDELRTADYLQQGLRENGYVVDCAHTGTDGLHLARQQPYELVILDVNLPELDGWTVLQRLRAESATRIMMLTAH
GRLADRVKGLDLGADDYLLKPFEFPELLARIRSLLRRNDQQLQPSTLRVADLELDPGRHRAYRAGQRIDLTAKEFALLHL
LMRQTGEVLSRTQIISLVWDMNFDCDTNVVEVSIRRLRAKIDDPFDNKLIHTLRGVGYVLEARF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-56 53
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-55 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator BAC0125 Protein 9e-66 60
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator BAC0083 Protein 8e-62 59
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator BAC0197 Protein 5e-64 59
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator BAC0638 Protein 1e-55 59
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator BAC0308 Protein 2e-57 55
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator BAC0111 Protein 4e-61 54
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator BAC0347 Protein 2e-57 51
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 2e-37 43
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 2e-37 43
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 2e-37 43
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 2e-37 43
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 2e-37 43
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 2e-37 43
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 2e-37 43
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 2e-37 43
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 1e-32 41
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator U82965.2.orf14.gene. Protein 2e-33 41
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 7e-29 41
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator CP001918.1.gene5135. Protein 6e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator VFG0596 Protein 2e-56 53
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator VFG1389 Protein 2e-36 44
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator VFG1386 Protein 3e-38 43
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator VFG1390 Protein 3e-38 42
PputGB1_4369 YP_001670593.1 two component heavy metal response transcriptional regulator VFG0473 Protein 2e-30 41