Gene Information

Name : T1E_4698 (T1E_4698)
Accession : YP_006535319.1
Strain : Pseudomonas putida DOT-T1E
Genome accession: NC_018220
Putative virulence/resistance : Virulence
Product : DNA-binding heavy metal response regulator, puta
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5135055 - 5135729 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
ATGCGAATTCTGGTAATTGAGGATGAAGTAAAAACTGCGGAGTATGTGCGTCAAGGCCTTACAGAGTGTGGCTATGTCGT
AGATTGCGTCCACACCGGATCAGATGGATTATTCTTGGCCAAGCAGCATGAGTACGAGCTGATTATCCTCGATATAAACC
TACCAGAGATGGACGGTTGGCAGGTCCTTGAGTTGTTGCGCCGTAAAAACTGCCCGTCCCGCATCATGATGCTGACGGCG
AGAAGCCGATTGGCGGATAAGGTCCGGGGGCTGGAGAACGGCGCAGATGACTATCTGATCAAACCATTTGAGTTCCCAGA
GCTGCTAGCCCGGGTTCGCGCCTTGATGCGCAGGTCAGATCACCCCGCATCTGTGGAGGTCATTCGCGTGGCCGATCTGG
AACTTGATCAAAGCCGGCACAGGGCATTCAGGGACGGTCAGCGTATTGATTTGACCACCAAAGAATTCGCGTTGCTGCAC
TACTTGATGCGTAACACCGGGGTGGTACTGAGCCGTACGCAGATTATCTCTCAGGTTTGGGATATGAATTTTGATTGCGA
CACGAACGTTGTAGAGGTGTCGATTCGAAGACTCAGAGCCAAGATAGATGACCCCTTCGAAACCAAGCTGATACACACAC
TTAGAGGCGTAGGGTATGTACTTGAAAAGCGTTAA

Protein sequence :
MRILVIEDEVKTAEYVRQGLTECGYVVDCVHTGSDGLFLAKQHEYELIILDINLPEMDGWQVLELLRRKNCPSRIMMLTA
RSRLADKVRGLENGADDYLIKPFEFPELLARVRALMRRSDHPASVEVIRVADLELDQSRHRAFRDGQRIDLTTKEFALLH
YLMRNTGVVLSRTQIISQVWDMNFDCDTNVVEVSIRRLRAKIDDPFETKLIHTLRGVGYVLEKR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-55 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-54 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
T1E_4698 YP_006535319.1 DNA-binding heavy metal response regulator, puta BAC0197 Protein 5e-62 59
T1E_4698 YP_006535319.1 DNA-binding heavy metal response regulator, puta BAC0125 Protein 8e-61 58
T1E_4698 YP_006535319.1 DNA-binding heavy metal response regulator, puta BAC0083 Protein 2e-57 56
T1E_4698 YP_006535319.1 DNA-binding heavy metal response regulator, puta BAC0638 Protein 1e-54 56
T1E_4698 YP_006535319.1 DNA-binding heavy metal response regulator, puta BAC0308 Protein 2e-56 54
T1E_4698 YP_006535319.1 DNA-binding heavy metal response regulator, puta BAC0111 Protein 1e-59 53
T1E_4698 YP_006535319.1 DNA-binding heavy metal response regulator, puta BAC0347 Protein 2e-54 49
T1E_4698 YP_006535319.1 DNA-binding heavy metal response regulator, puta NC_007793.3914065.p0 Protein 1e-34 42
T1E_4698 YP_006535319.1 DNA-binding heavy metal response regulator, puta NC_007622.3794948.p0 Protein 1e-34 42
T1E_4698 YP_006535319.1 DNA-binding heavy metal response regulator, puta NC_002951.3238224.p0 Protein 1e-34 42
T1E_4698 YP_006535319.1 DNA-binding heavy metal response regulator, puta NC_002952.2859858.p0 Protein 1e-34 42
T1E_4698 YP_006535319.1 DNA-binding heavy metal response regulator, puta NC_013450.8614146.p0 Protein 1e-34 42
T1E_4698 YP_006535319.1 DNA-binding heavy metal response regulator, puta NC_010079.5776364.p0 Protein 1e-34 42
T1E_4698 YP_006535319.1 DNA-binding heavy metal response regulator, puta NC_003923.1003417.p0 Protein 1e-34 42
T1E_4698 YP_006535319.1 DNA-binding heavy metal response regulator, puta NC_002758.1121390.p0 Protein 1e-34 42
T1E_4698 YP_006535319.1 DNA-binding heavy metal response regulator, puta AE015929.1.gene1106. Protein 4e-30 41
T1E_4698 YP_006535319.1 DNA-binding heavy metal response regulator, puta NC_012469.1.7685629. Protein 4e-31 41
T1E_4698 YP_006535319.1 DNA-binding heavy metal response regulator, puta AE000516.2.gene3505. Protein 2e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
T1E_4698 YP_006535319.1 DNA-binding heavy metal response regulator, puta VFG0596 Protein 3e-55 55
T1E_4698 YP_006535319.1 DNA-binding heavy metal response regulator, puta VFG1389 Protein 6e-35 45
T1E_4698 YP_006535319.1 DNA-binding heavy metal response regulator, puta VFG1390 Protein 9e-37 42
T1E_4698 YP_006535319.1 DNA-binding heavy metal response regulator, puta VFG1386 Protein 2e-36 41