Gene Information

Name : L083_4780 (L083_4780)
Accession : YP_007952771.1
Strain : Actinoplanes sp. N902-109
Genome accession: NC_021191
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5521539 - 5522255 bp
Length : 717 bp
Strand : -
Note : -

DNA sequence :
GTGCCCGCCACCGCCCGCGAGGCCCGGGTGCTGGTGGTCGACGACGAGCCCAACATCTCGGCGTTGTTGTCGGCCACGCT
GCGCCTCGTCGAGTTCGACGTCCGGGTTGCCGAGTCCGGCCACGGCGCGCTGGCGGCGGTCGAGGCGTTCGAGCCCGACC
TGGTCGTCCTCGACGTGATGCTGCCCGATCTGGACGGCTTCGAGGTGGCCCGGCGGCTGCGCGCGGCCGGGTGCGGCACG
CCGGTGCTGTTCCTGACCGCGCGGGACACCGTCGAGGACCGGGTGGCCGGGCTCACCGCCGGCGCCGACGACTACGTGGC
CAAGCCGTTCAGCCTGGAGGAGGTCGTGCTGCGGATCCGGGCCATCCTGCGGCGCAGCCAGCCCGAGCTGGCCGCCCAGC
CCGGTGCGGCCACGCTGCGCTATGCCGATCTGGAGCTGGACGAGGACGCCCACGAGGTGCGCCGGGCGGGCCGGTTGATC
GACCTGTCGCCGACCGAGTTCAACCTGCTCAAGTATCTGATGATCAACTCCGGCCGGGTGGTCAGCAAGGCGCAGATCCT
GGACCGGGTGTGGAAGTACGACTTCGGCGGGGACGGGCGGATCGTCGAGTCGTACGTCTACTACCTGCGGCGCAAGATCG
ACAAGACCGGCCAGCCGCTGATCCACACCGTGCGCGGTGTCGGGTATGCCCTCCGGCTGCCCCGCGGGGACGAATGA

Protein sequence :
MPATAREARVLVVDDEPNISALLSATLRLVEFDVRVAESGHGALAAVEAFEPDLVVLDVMLPDLDGFEVARRLRAAGCGT
PVLFLTARDTVEDRVAGLTAGADDYVAKPFSLEEVVLRIRAILRRSQPELAAQPGAATLRYADLELDEDAHEVRRAGRLI
DLSPTEFNLLKYLMINSGRVVSKAQILDRVWKYDFGGDGRIVESYVYYLRRKIDKTGQPLIHTVRGVGYALRLPRGDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 1e-25 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-24 42
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 4e-25 41
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 4e-25 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 4e-25 41
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 4e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
L083_4780 YP_007952771.1 two component transcriptional regulator BAC0197 Protein 3e-32 47
L083_4780 YP_007952771.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-32 45
L083_4780 YP_007952771.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-35 44
L083_4780 YP_007952771.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-35 44
L083_4780 YP_007952771.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-35 44
L083_4780 YP_007952771.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-35 44
L083_4780 YP_007952771.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-35 44
L083_4780 YP_007952771.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-35 44
L083_4780 YP_007952771.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 8e-35 44
L083_4780 YP_007952771.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-35 44
L083_4780 YP_007952771.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-35 44
L083_4780 YP_007952771.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-35 44
L083_4780 YP_007952771.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-25 44
L083_4780 YP_007952771.1 two component transcriptional regulator BAC0125 Protein 5e-29 43
L083_4780 YP_007952771.1 two component transcriptional regulator BAC0083 Protein 2e-32 42
L083_4780 YP_007952771.1 two component transcriptional regulator BAC0638 Protein 2e-26 42
L083_4780 YP_007952771.1 two component transcriptional regulator NC_012469.1.7685629. Protein 4e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
L083_4780 YP_007952771.1 two component transcriptional regulator VFG1386 Protein 8e-58 59
L083_4780 YP_007952771.1 two component transcriptional regulator VFG1390 Protein 1e-44 51
L083_4780 YP_007952771.1 two component transcriptional regulator VFG1389 Protein 8e-34 45
L083_4780 YP_007952771.1 two component transcriptional regulator VFG0596 Protein 4e-24 42