Gene Information

Name : S58_48770 (S58_48770)
Accession : YP_007514443.1
Strain : Bradyrhizobium oligotrophicum S58
Genome accession: NC_020453
Putative virulence/resistance : Virulence
Product : putative two-component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5510158 - 5510838 bp
Length : 681 bp
Strand : -
Note : -

DNA sequence :
ATGCGCCTGCTGATCATCGAAGACGACCGCGAATCCGCCGACTATCTGGTCAAGGCGTTCCGCGAGGTCGGACATGTCGC
CGACCTCGCCAGCGACGGCGAGGAGGGCCTCGCCATGGCCGAGAGCGGGGATTACGACGTGCTGGTGGTCGACCGGATGC
TGCCGAAGCGCGACGGCCTGTCCGTGATCGGCGCGCTGCGCGACAAGGGCAACCGCGCCCCGGTCCTGATCCTGTCCGCG
CTTGGCCAGGTCGACGACCGCATCAAGGGCCTGCGCGCCGGCGGCGACGATTACCTGCCCAAGCCCTACGCCTTCGCCGA
GCTGCTCGCCCGCGTCGAAGTGCTGTCGCGCCGTCATGGCGGGCCGGCCGAGGAGACCACCTACAAGGTCGGCGATCTCG
AGCTCGATCGGCTGTCGCATCGCGTTGCGCGCGGCAAGGACGAGCTGACCCTGCAGCCGCGCGAGTTCCGGCTGCTCGAA
TATCTGATGAAGCATGCCGGCCAGGTGGTGACGCGCACCATGCTGCTGGAGAACGTCTGGGACTATCATTTCGACCCGCA
GACCAACGTGATCGACGTCCACATCTCGCGGCTGCGCTCCAAGATCGACAAGGGTTTCGAGCGGCCGCTGCTCCATACCA
TCCGCGGCGCGGGGTACATGATTCGTGACGGCCTTCGGTAA

Protein sequence :
MRLLIIEDDRESADYLVKAFREVGHVADLASDGEEGLAMAESGDYDVLVVDRMLPKRDGLSVIGALRDKGNRAPVLILSA
LGQVDDRIKGLRAGGDDYLPKPYAFAELLARVEVLSRRHGGPAEETTYKVGDLELDRLSHRVARGKDELTLQPREFRLLE
YLMKHAGQVVTRTMLLENVWDYHFDPQTNVIDVHISRLRSKIDKGFERPLLHTIRGAGYMIRDGLR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-39 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
S58_48770 YP_007514443.1 putative two-component transcriptional regulator BAC0125 Protein 4e-50 48
S58_48770 YP_007514443.1 putative two-component transcriptional regulator BAC0111 Protein 1e-53 47
S58_48770 YP_007514443.1 putative two-component transcriptional regulator BAC0083 Protein 1e-46 47
S58_48770 YP_007514443.1 putative two-component transcriptional regulator BAC0308 Protein 8e-45 45
S58_48770 YP_007514443.1 putative two-component transcriptional regulator BAC0197 Protein 1e-44 45
S58_48770 YP_007514443.1 putative two-component transcriptional regulator BAC0638 Protein 4e-39 45
S58_48770 YP_007514443.1 putative two-component transcriptional regulator BAC0347 Protein 6e-46 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
S58_48770 YP_007514443.1 putative two-component transcriptional regulator VFG1389 Protein 2e-34 45
S58_48770 YP_007514443.1 putative two-component transcriptional regulator VFG1390 Protein 3e-40 42
S58_48770 YP_007514443.1 putative two-component transcriptional regulator VFG0473 Protein 2e-29 41
S58_48770 YP_007514443.1 putative two-component transcriptional regulator VFG0596 Protein 6e-40 41