Gene Information

Name : irlR1 (AXYL_00494)
Accession : YP_003976567.1
Strain : Achromobacter xylosoxidans A8
Genome accession: NC_014640
Putative virulence/resistance : Virulence
Product : transcriptional activator protein IrlR 1
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 518484 - 519173 bp
Length : 690 bp
Strand : -
Note : -

DNA sequence :
ATGCGCATCCTGGTCATCGAAGACGAACCCAAACTGGCCGACTACCTGAAGAAGGGGCTGTCGGAGCAAAGCCATGTCGT
GGACCTGGCGCGCGACGGCGTGGACGGCCTGCACCTGGCGCTGGAAGGCGTCTACGACCTGATCGTGCTGGACGTGATGC
TGCCGGGCGTGGACGGCTTCGGCGTGCTGGCCGCGGTGCGCGAACAGAAAGACACCCCCATCCTGATGCTGACCGCGCGC
GACGCGGTCGAGGACCGCGTGCGCGGCCTGGAAGGCGGCGCCGACGACTACCTGGTCAAGCCCTTCGCCTTTTCGGAACT
GCTGGCGCGGGTGCAGGCGCTGCTGCGCCGCGGACGCTCGCAAGAGCCCACCCTGCTGCGCCTGGCCGACCTGGAACTGG
ACCTGGCCCGCCGCCGCGCCCAGCGCGGCGGCCGTCGCCTGGACCTGACCGCCAAGGAATTCAATCTGCTGGCCTTGCTG
CTACGCCGCCAGGGCCAGGTGCTGTCGCGCACCACCCTGGCCGAGCAGGTCTGGGACATGAACTTCGACAGCGACACCAA
CGTCATCGACGTGGCGGTGCGGCGGCTGCGCAGCAAGCTGGACGACCCCTACGACACCAAGTTGCTGCACACCGTGCGCG
GCATGGGCTACGTGCTGGAATCGCGCCCCGCCCACGGCCGCCCCGCATGA

Protein sequence :
MRILVIEDEPKLADYLKKGLSEQSHVVDLARDGVDGLHLALEGVYDLIVLDVMLPGVDGFGVLAAVREQKDTPILMLTAR
DAVEDRVRGLEGGADDYLVKPFAFSELLARVQALLRRGRSQEPTLLRLADLELDLARRRAQRGGRRLDLTAKEFNLLALL
LRRQGQVLSRTTLAEQVWDMNFDSDTNVIDVAVRRLRSKLDDPYDTKLLHTVRGMGYVLESRPAHGRPA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-51 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-51 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 BAC0197 Protein 2e-59 64
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 BAC0125 Protein 9e-59 63
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 BAC0083 Protein 3e-52 62
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 BAC0638 Protein 9e-47 62
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 BAC0308 Protein 1e-52 58
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 BAC0111 Protein 7e-54 56
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 BAC0347 Protein 3e-46 54
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 HE999704.1.gene1528. Protein 8e-29 45
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 NC_002516.2.879194.p Protein 3e-28 44
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 NC_007793.3914065.p0 Protein 3e-35 43
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 NC_007622.3794948.p0 Protein 3e-35 43
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 NC_002951.3238224.p0 Protein 3e-35 43
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 NC_002952.2859858.p0 Protein 3e-35 43
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 NC_013450.8614146.p0 Protein 3e-35 43
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 NC_010079.5776364.p0 Protein 3e-35 43
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 NC_003923.1003417.p0 Protein 3e-35 43
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 NC_002758.1121390.p0 Protein 3e-35 43
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 NC_002952.2859905.p0 Protein 6e-29 42
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 AE000516.2.gene3505. Protein 5e-24 42
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 NC_007622.3794472.p0 Protein 5e-29 41
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 NC_007793.3914279.p0 Protein 8e-29 41
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 NC_002951.3237708.p0 Protein 8e-29 41
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 NC_013450.8614421.p0 Protein 8e-29 41
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 NC_009782.5559369.p0 Protein 8e-29 41
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 NC_009641.5332272.p0 Protein 8e-29 41
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 NC_002745.1124361.p0 Protein 8e-29 41
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 NC_002758.1121668.p0 Protein 8e-29 41
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 U82965.2.orf14.gene. Protein 3e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 VFG0596 Protein 6e-52 54
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 VFG1389 Protein 8e-31 46
irlR1 YP_003976567.1 transcriptional activator protein IrlR 1 VFG1390 Protein 2e-35 45