Gene Information

Name : G655_25765 (G655_25765)
Accession : YP_007711983.1
Strain : Pseudomonas aeruginosa B136-33
Genome accession: NC_020912
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5633129 - 5633818 bp
Length : 690 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGCGCATCCTGGTGATCGAAGACGATACGAAGACCGGCGAGTACCTGAAGAAGGGCCTCGGCGAGTCGGGCTATGCGGT
CGACTGGTCGCAGCACGGCGCCGACGGTCTCTACCTGGCGCTGGAGAACCGCTACGACCTGGTGGTCCTCGACGTGATGC
TGCCCGGCCTGGACGGTTGGCAGATCATGGAAGTGCTGCGCAAGAAGCACGATGTGCCGGTGCTCTTCCTCACCGCCCGC
GACCAGTTGCAGGACCGTATCCGCGGCCTCGAACTGGGTGCCGACGACTACCTGGTGAAACCCTTCTCCTTCACCGAGTT
GCTGCTGCGTATCCGTACCCTGCTGCGCCGCGGCGTGGTCCGCGAGGCAGAGCAGGTGCAACTGGCCGATCTGCACCTGG
ACGTGCTGCGGCGCAAGGTCAGCCGCCAGGGGCAGGTGATCGCCCTGACCAACAAGGAGTTCGCCCTCCTGCACCTGCTG
ATGCGCCGCGAGGGCGAGGTGCTGTCGCGCACCCTGATCGCCTCGGAGGTCTGGGACATGAACTTCGACAGCGACACCAA
CGTCGTCGACGTGGCGATCAAGCGCCTGCGCGCCAAGGTCGACAATCCCTTCCCGAACAAGCTGATCCATACCGTGCGCG
GCATCGGCTACGTCTGCGAGGAGCGCCCGTGCCCGCCCGCCGCTCCCTGA

Protein sequence :
MRILVIEDDTKTGEYLKKGLGESGYAVDWSQHGADGLYLALENRYDLVVLDVMLPGLDGWQIMEVLRKKHDVPVLFLTAR
DQLQDRIRGLELGADDYLVKPFSFTELLLRIRTLLRRGVVREAEQVQLADLHLDVLRRKVSRQGQVIALTNKEFALLHLL
MRREGEVLSRTLIASEVWDMNFDSDTNVVDVAIKRLRAKVDNPFPNKLIHTVRGIGYVCEERPCPPAAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-53 58
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-54 57

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
G655_25765 YP_007711983.1 two-component response regulator BAC0125 Protein 1e-63 64
G655_25765 YP_007711983.1 two-component response regulator BAC0197 Protein 6e-66 62
G655_25765 YP_007711983.1 two-component response regulator BAC0083 Protein 2e-58 61
G655_25765 YP_007711983.1 two-component response regulator BAC0308 Protein 2e-56 60
G655_25765 YP_007711983.1 two-component response regulator BAC0111 Protein 3e-57 58
G655_25765 YP_007711983.1 two-component response regulator BAC0638 Protein 2e-52 57
G655_25765 YP_007711983.1 two-component response regulator BAC0347 Protein 4e-51 56
G655_25765 YP_007711983.1 two-component response regulator AE000516.2.gene3505. Protein 2e-30 42
G655_25765 YP_007711983.1 two-component response regulator U82965.2.orf14.gene. Protein 2e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
G655_25765 YP_007711983.1 two-component response regulator VFG0596 Protein 4e-54 57
G655_25765 YP_007711983.1 two-component response regulator VFG1390 Protein 2e-34 44
G655_25765 YP_007711983.1 two-component response regulator VFG1386 Protein 1e-30 43
G655_25765 YP_007711983.1 two-component response regulator VFG0473 Protein 2e-25 42
G655_25765 YP_007711983.1 two-component response regulator VFG1389 Protein 9e-29 42