Gene Information

Name : cusR (ECD_00532)
Accession : YP_003053183.1
Strain : Escherichia coli BL21(DE3)
Genome accession: NC_012971
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator in two-component regulatory system with CusS
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 553442 - 554125 bp
Length : 684 bp
Strand : -
Note : similar to b0571

DNA sequence :
ATGAAACTGTTGATTGTCGAAGATGAAAAGAAAACCGGAGAATACTTGACCAAAGGGTTAACCGAAGCCGGTTTTGTGGT
CGATTTGGCCGACAACGGGCTGAATGGCTACCATCTGGCGATGACCGGTGATTATGATCTGATAATCCTCGATATTATGC
TGCCGGACGTGAACGGCTGGGATATCGTGCGCATGTTACGCTCCGCCAATAAAGGGATGCCGATTCTGTTGCTTACCGCG
CTTGGCACCATTGAACATCGCGTCAAGGGGCTGGAGTTGGGGGCAGATGACTACCTGATGAAACCATTCGCTTTTGCTGA
ACTGCTGGCGCGGGTGCGCACTCTCCTGCGGCGCGGGGCGGCGGTAATTATCGAAAGTCAGTTTCAGGTTGCCGACCTGA
TGGTCGATCTCGTCAGCCGCAAAGTCACCCGCAGCGGCACGCGCATCACTCTGACCAGTAAAGAGTTTACTCTGCTGGAG
TTTTTTCTCCGCCATCAGGGCGAAGTGCTGCCCCGCTCGCTTATCGCCTCGCAGGTGTGGGACATGAATTTCGACAGCGA
CACTAACGCCATTGATGTGGCGGTGAAGCGGCTACGCGGCAAAATCGACAACGACTTTGAGCCGAAGCTGATTCAGACCG
TGCGCGGCGTGGGCTATATGCTTGAGGTGCCGGATGGTCAGTAA

Protein sequence :
MKLLIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAMTGDYDLIILDIMLPDVNGWDIVRMLRSANKGMPILLLTA
LGTIEHRVKGLELGADDYLMKPFAFAELLARVRTLLRRGAAVIIESQFQVADLMVDLVSRKVTRSGTRITLTSKEFTLLE
FFLRHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRGKIDNDFEPKLIQTVRGVGYMLEVPDGQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-56 52
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-56 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_003053183.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0111 Protein 1e-103 99
cusR YP_003053183.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0347 Protein 5e-87 82
cusR YP_003053183.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0638 Protein 3e-63 62
cusR YP_003053183.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0083 Protein 3e-70 61
cusR YP_003053183.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0308 Protein 1e-63 60
cusR YP_003053183.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0197 Protein 2e-63 59
cusR YP_003053183.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0125 Protein 1e-63 56
cusR YP_003053183.1 DNA-binding response regulator in two-component regulatory system with CusS AE000516.2.gene3505. Protein 6e-28 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_003053183.1 DNA-binding response regulator in two-component regulatory system with CusS VFG0596 Protein 2e-56 52
cusR YP_003053183.1 DNA-binding response regulator in two-component regulatory system with CusS VFG1390 Protein 3e-43 43