Gene Information

Name : Rhom172_0511 (Rhom172_0511)
Accession : YP_004824292.1
Strain : Rhodothermus marinus SG0.5JP17-172
Genome accession: NC_015966
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 582697 - 583383 bp
Length : 687 bp
Strand : -
Note : KEGG: rmr:Rmar_0513 two component transcriptional regulator, winged helix family; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver re

DNA sequence : 
ATGCCTCGTCCGATTTTACTGGTGGAAGACGAGATCGCCATGGCGGCCCTGTTGCGTCAGGGGTTGGAGGAAGAGGGCTA
CGCGGTCGAATGGGTGCTCACCGGCGAAGAAGCCCTGGCGCGCCTGGAGCATCTGGAGCCGGCCCTGCTGGTGCTGGACG
TACGACTGCCGGGCATGGATGGCGTGGAAGTGTGCCGCCAGGTACGCCAGCGCTGGCCGGATCTACCTGTTCTGATGCTG
ACGGTCCTCGACGATGTCGAAAATCGCGTGCGCGGGCTACGAGCCGGTGCCGACGACTATCTGCCCAAACCGTTCGCCTT
TGAAGAACTGCTGGCCCGGATCGAAGCCCTGCTGCGCCGAAGCAAGCGCCAGCCCACCCGCCACCTGCTGCGCAATGGTC
CGCTCACGCTCGACCTGAACGCCCGCACCGCCACCTGTGGCGAGCGCACGCTTTCCCTTACGCCGCGCGAATTCGATCTG
CTGGCCTACCTGATGCAACACCCCCGTCGGGCGATTTCGCGGCTGCAGATCTACCGCGAAGTGTGGGGCCACGACTTCGA
CCACGGCACCAGCCTGCTCGAAGTGTATATCAGCTACTTGCGCCGCAAATTGCAGGAAGCAGGCTGCCCGGGCTACATTG
CAACGGTCCGGGGCGTCGGTTACCGCTATGAACCGGCCGAAGGGTGA

Protein sequence : 
MPRPILLVEDEIAMAALLRQGLEEEGYAVEWVLTGEEALARLEHLEPALLVLDVRLPGMDGVEVCRQVRQRWPDLPVLML
TVLDDVENRVRGLRAGADDYLPKPFAFEELLARIEALLRRSKRQPTRHLLRNGPLTLDLNARTATCGERTLSLTPREFDL
LAYLMQHPRRAISRLQIYREVWGHDFDHGTSLLEVYISYLRRKLQEAGCPGYIATVRGVGYRYEPAEG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rhom172_0511 YP_004824292.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-27 43
Rhom172_0511 YP_004824292.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-24 43
Rhom172_0511 YP_004824292.1 winged helix family two component transcriptional regulator BAC0288 Protein 3e-26 42
Rhom172_0511 YP_004824292.1 winged helix family two component transcriptional regulator BAC0083 Protein 8e-27 42
Rhom172_0511 YP_004824292.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-26 41
Rhom172_0511 YP_004824292.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-26 41
Rhom172_0511 YP_004824292.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-26 41
Rhom172_0511 YP_004824292.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-26 41
Rhom172_0511 YP_004824292.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-26 41
Rhom172_0511 YP_004824292.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-26 41
Rhom172_0511 YP_004824292.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-26 41
Rhom172_0511 YP_004824292.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rhom172_0511 YP_004824292.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-37 52
Rhom172_0511 YP_004824292.1 winged helix family two component transcriptional regulator VFG1389 Protein 6e-28 43
Rhom172_0511 YP_004824292.1 winged helix family two component transcriptional regulator VFG0473 Protein 6e-18 41
Rhom172_0511 YP_004824292.1 winged helix family two component transcriptional regulator VFG0596 Protein 5e-21 41