Gene Information

Name : PPS_5251 (PPS_5251)
Accession : YP_004704658.1
Strain : Pseudomonas putida S16
Genome accession: NC_015733
Putative virulence/resistance : Virulence
Product : DNA-binding heavy metal response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5948022 - 5948696 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
ATGCGAATTCTGGTAATTGAGGACGAAGTAAAAACTGCGGAATATGTGCGTCAAGGCCTTACAGAATGCGGTTATGTCGT
CGATTGCGTGCATACCGGGTCAGATGGGCTATTCCTAGCCAAGCAACACGAATACGAGTTGATTATTCTTGATATCAATC
TGCCAGAAATGGATGGGTGGCAGGTACTTGAGCTTTTGAGGCGTAAAAATTGCCCCTCCCGCATCATGATGCTCACGGCG
AGAAGTCGTTTGGCAGATAAGGTCCGGGGTTTGGAGAACGGTGCAGATGACTACCTGATCAAACCATTTGAGTTCCCAGA
ACTGCTAGCCCGGGTTCGCGCCTTAATGCGCAGGTCTGAACACCCTGCATCTGTGGAGATCATTCGTGTCGCTGACCTGG
AGCTAGACCAGAGCCGTCACAGGGCCTTCAGGGACGGCCAGCGTATTGATCTGACGACGAAAGAGTTTGCACTTCTGCAC
TACCTAATGCGCAATACCGGCGTGGTGCTCAGCCGCACACAGATCATCTCACAGGTCTGGGATATGAACTTCGACTGCGA
TACAAACGTTGTAGAAGTGTCGATTCGAAGACTTAGAGCCAAGATCGATGACCCTTTCGAGACGAAGCTGATCCATACGC
TTCGCGGTGTGGGCTATGTGCTTGAGAAGCGTTGA

Protein sequence :
MRILVIEDEVKTAEYVRQGLTECGYVVDCVHTGSDGLFLAKQHEYELIILDINLPEMDGWQVLELLRRKNCPSRIMMLTA
RSRLADKVRGLENGADDYLIKPFEFPELLARVRALMRRSEHPASVEIIRVADLELDQSRHRAFRDGQRIDLTTKEFALLH
YLMRNTGVVLSRTQIISQVWDMNFDCDTNVVEVSIRRLRAKIDDPFETKLIHTLRGVGYVLEKR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-55 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-54 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PPS_5251 YP_004704658.1 DNA-binding heavy metal response regulator BAC0125 Protein 8e-61 58
PPS_5251 YP_004704658.1 DNA-binding heavy metal response regulator BAC0197 Protein 5e-62 58
PPS_5251 YP_004704658.1 DNA-binding heavy metal response regulator BAC0083 Protein 2e-57 56
PPS_5251 YP_004704658.1 DNA-binding heavy metal response regulator BAC0638 Protein 1e-54 56
PPS_5251 YP_004704658.1 DNA-binding heavy metal response regulator BAC0308 Protein 2e-56 54
PPS_5251 YP_004704658.1 DNA-binding heavy metal response regulator BAC0111 Protein 1e-59 53
PPS_5251 YP_004704658.1 DNA-binding heavy metal response regulator BAC0347 Protein 2e-54 49
PPS_5251 YP_004704658.1 DNA-binding heavy metal response regulator NC_007793.3914065.p0 Protein 7e-35 43
PPS_5251 YP_004704658.1 DNA-binding heavy metal response regulator NC_007622.3794948.p0 Protein 7e-35 43
PPS_5251 YP_004704658.1 DNA-binding heavy metal response regulator NC_002951.3238224.p0 Protein 7e-35 43
PPS_5251 YP_004704658.1 DNA-binding heavy metal response regulator NC_002952.2859858.p0 Protein 7e-35 43
PPS_5251 YP_004704658.1 DNA-binding heavy metal response regulator NC_013450.8614146.p0 Protein 7e-35 43
PPS_5251 YP_004704658.1 DNA-binding heavy metal response regulator NC_010079.5776364.p0 Protein 7e-35 43
PPS_5251 YP_004704658.1 DNA-binding heavy metal response regulator NC_003923.1003417.p0 Protein 7e-35 43
PPS_5251 YP_004704658.1 DNA-binding heavy metal response regulator NC_002758.1121390.p0 Protein 7e-35 43
PPS_5251 YP_004704658.1 DNA-binding heavy metal response regulator AE015929.1.gene1106. Protein 5e-30 41
PPS_5251 YP_004704658.1 DNA-binding heavy metal response regulator NC_012469.1.7685629. Protein 5e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PPS_5251 YP_004704658.1 DNA-binding heavy metal response regulator VFG0596 Protein 2e-55 55
PPS_5251 YP_004704658.1 DNA-binding heavy metal response regulator VFG1389 Protein 6e-35 45
PPS_5251 YP_004704658.1 DNA-binding heavy metal response regulator VFG1390 Protein 1e-36 42
PPS_5251 YP_004704658.1 DNA-binding heavy metal response regulator VFG1386 Protein 2e-36 41