Gene Information

Name : mprA (CU7111_0527)
Accession : YP_007416365.1
Strain : Corynebacterium urealyticum DSM 7111
Genome accession: NC_020230
Putative virulence/resistance : Virulence
Product : two-component system response regulator MprA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 635086 - 635781 bp
Length : 696 bp
Strand : +
Note : -

DNA sequence :
ATGAAGATTCTCGTTGTGGACGATGACCCGGCTGTACGCGAGTCGCTGCGTCGTTCCCTGATTTTCAATGGGTACGCCGT
CGTGCTCGCCGCGGACGGGGAGGAAGCGCTGGATAAAGTTCAGTCCGAGCGTCCCGACATGGCGATCCTCGACGTCATGA
TGCCGAAGCTCGACGGGCTCGAAGTGTGTCGCGAGCTGCGTTCCCAGGGCGATGACATCCCAATCCTCCTGCTCACGGCC
CGCGACTCCGTCTCGGAGCGCGTCGCCGGGCTGGATGCGGGCGCGGACGATTACCTCACCAAGCCCTTTGCGCTCGAGGA
GCTTCTGGCTCGCACCCGCTCCCTCGTCCGTCGCGCCGCACGCCCGGCGGCGGTGGACACCCAGCAGACCGAGATCCTGA
AGTTCGAGGACCTCGAACTTGATCCCGCGACCCGCGACGTCACGCGCGGCAGCCGCCAGATCAGCCTGACCCGCACCGAG
TTCGCGCTGCTGGAGCTGCTGCTGCGAAACCCCCGCAAGGTGCTCTCTCGCACGACAATCCTTGAGGACGTGTGGGGCTA
TGACTTCCCGACCTCCGGCAATGCTTTGGAGGTTTACATCGGCTACCTGCGTCGCAAGACCGAGGCCGACGGCGAGCCGC
GTCTGATCCAGACGGTGCGCGGCGTGGGTTACGTTCTGCGCGAGACCGCACCATGA

Protein sequence :
MKILVVDDDPAVRESLRRSLIFNGYAVVLAADGEEALDKVQSERPDMAILDVMMPKLDGLEVCRELRSQGDDIPILLLTA
RDSVSERVAGLDAGADDYLTKPFALEELLARTRSLVRRAARPAAVDTQQTEILKFEDLELDPATRDVTRGSRQISLTRTE
FALLELLLRNPRKVLSRTTILEDVWGYDFPTSGNALEVYIGYLRRKTEADGEPRLIQTVRGVGYVLRETAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-38 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-37 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mprA YP_007416365.1 two-component system response regulator MprA BAC0083 Protein 3e-43 48
mprA YP_007416365.1 two-component system response regulator MprA BAC0638 Protein 5e-36 46
mprA YP_007416365.1 two-component system response regulator MprA BAC0125 Protein 4e-42 45
mprA YP_007416365.1 two-component system response regulator MprA BAC0111 Protein 7e-43 45
mprA YP_007416365.1 two-component system response regulator MprA HE999704.1.gene1528. Protein 1e-37 44
mprA YP_007416365.1 two-component system response regulator MprA AE000516.2.gene3505. Protein 8e-38 44
mprA YP_007416365.1 two-component system response regulator MprA BAC0347 Protein 6e-38 43
mprA YP_007416365.1 two-component system response regulator MprA BAC0197 Protein 2e-39 43
mprA YP_007416365.1 two-component system response regulator MprA NC_007622.3794948.p0 Protein 1e-41 42
mprA YP_007416365.1 two-component system response regulator MprA NC_003923.1003417.p0 Protein 1e-41 42
mprA YP_007416365.1 two-component system response regulator MprA NC_013450.8614146.p0 Protein 1e-41 42
mprA YP_007416365.1 two-component system response regulator MprA NC_002951.3238224.p0 Protein 1e-41 42
mprA YP_007416365.1 two-component system response regulator MprA NC_007793.3914065.p0 Protein 1e-41 42
mprA YP_007416365.1 two-component system response regulator MprA NC_002758.1121390.p0 Protein 1e-41 42
mprA YP_007416365.1 two-component system response regulator MprA NC_010079.5776364.p0 Protein 1e-41 42
mprA YP_007416365.1 two-component system response regulator MprA NC_002952.2859858.p0 Protein 1e-41 42
mprA YP_007416365.1 two-component system response regulator MprA BAC0308 Protein 9e-40 42
mprA YP_007416365.1 two-component system response regulator MprA AF155139.2.orf0.gene Protein 5e-37 42
mprA YP_007416365.1 two-component system response regulator MprA NC_002952.2859905.p0 Protein 2e-42 42
mprA YP_007416365.1 two-component system response regulator MprA NC_009641.5332272.p0 Protein 2e-42 42
mprA YP_007416365.1 two-component system response regulator MprA NC_013450.8614421.p0 Protein 2e-42 42
mprA YP_007416365.1 two-component system response regulator MprA NC_007793.3914279.p0 Protein 2e-42 42
mprA YP_007416365.1 two-component system response regulator MprA NC_002745.1124361.p0 Protein 2e-42 42
mprA YP_007416365.1 two-component system response regulator MprA NC_009782.5559369.p0 Protein 2e-42 42
mprA YP_007416365.1 two-component system response regulator MprA NC_002951.3237708.p0 Protein 2e-42 42
mprA YP_007416365.1 two-component system response regulator MprA NC_007622.3794472.p0 Protein 2e-42 42
mprA YP_007416365.1 two-component system response regulator MprA NC_003923.1003749.p0 Protein 2e-42 42
mprA YP_007416365.1 two-component system response regulator MprA NC_002758.1121668.p0 Protein 2e-42 42
mprA YP_007416365.1 two-component system response regulator MprA AE015929.1.gene1106. Protein 2e-37 41
mprA YP_007416365.1 two-component system response regulator MprA NC_012469.1.7685629. Protein 2e-37 41
mprA YP_007416365.1 two-component system response regulator MprA CP004022.1.gene3215. Protein 7e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mprA YP_007416365.1 two-component system response regulator MprA VFG1390 Protein 2e-82 76
mprA YP_007416365.1 two-component system response regulator MprA VFG1386 Protein 1e-51 49
mprA YP_007416365.1 two-component system response regulator MprA VFG1389 Protein 1e-48 49
mprA YP_007416365.1 two-component system response regulator MprA VFG0596 Protein 2e-38 42