Gene Information

Name : cusR (ECDH1ME8569_0539)
Accession : YP_006127940.1
Strain : Escherichia coli DH1
Genome accession: NC_017638
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator in two-component regulatory system with CusS
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 585020 - 585703 bp
Length : 684 bp
Strand : -
Note : -

DNA sequence :
ATGAAACTGTTGATTGTCGAAGATGAAAAGAAAACCGGAGAATACTTGACCAAAGGGTTAACCGAAGCCGGTTTTGTGGT
CGATTTGGCCGACAACGGGCTGAATGGCTACCATCTGGCGATGACCGGTGATTATGATCTGATAATCCTCGATATTATGC
TGCCGGACGTGAACGGCTGGGATATCGTGCGCATGTTACGCTCCGCCAATAAAGGGATGCCGATTCTGTTGCTTACCGCG
CTTGGCACCATTGAACATCGCGTCAAGGGGCTGGAGTTGGGGGCAGATGACTACCTGGTGAAGCCATTCGCTTTTGCTGA
ACTGCTGGCGCGGGTGCGCACATTACTGCGGCGCGGGGCGGCGGTGATTATCGAAAGTCAGTTTCAGGTTGCCGATTTGA
TGGTCGATCTCGTCAGCCGCAAAGTCACCCGCAGCGGCACGCGCATCACTTTGACCAGTAAAGAGTTTACTCTGCTGGAG
TTCTTCCTTCGCCATCAGGGCGAAGTGCTGCCCCGCTCGCTTATCGCCTCGCAGGTATGGGACATGAATTTTGACAGCGA
TACCAATGCTATTGATGTGGCGGTGAAGCGGCTGCGCGGCAAAATCGACAACGACTTTGAGCCGAAGCTAATTCAGACCG
TGCGCGGCGTGGGTTACATGCTTGAGGTGCCGGATGGTCAGTAA

Protein sequence :
MKLLIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAMTGDYDLIILDIMLPDVNGWDIVRMLRSANKGMPILLLTA
LGTIEHRVKGLELGADDYLVKPFAFAELLARVRTLLRRGAAVIIESQFQVADLMVDLVSRKVTRSGTRITLTSKEFTLLE
FFLRHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRGKIDNDFEPKLIQTVRGVGYMLEVPDGQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-56 53
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-56 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_006127940.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0111 Protein 6e-104 100
cusR YP_006127940.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0347 Protein 2e-87 83
cusR YP_006127940.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0083 Protein 1e-70 62
cusR YP_006127940.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0638 Protein 2e-63 62
cusR YP_006127940.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0308 Protein 1e-63 60
cusR YP_006127940.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0197 Protein 9e-64 59
cusR YP_006127940.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0125 Protein 7e-64 56
cusR YP_006127940.1 DNA-binding response regulator in two-component regulatory system with CusS AE000516.2.gene3505. Protein 2e-27 42
cusR YP_006127940.1 DNA-binding response regulator in two-component regulatory system with CusS NC_003923.1003417.p0 Protein 2e-34 41
cusR YP_006127940.1 DNA-binding response regulator in two-component regulatory system with CusS NC_013450.8614146.p0 Protein 2e-34 41
cusR YP_006127940.1 DNA-binding response regulator in two-component regulatory system with CusS NC_002951.3238224.p0 Protein 2e-34 41
cusR YP_006127940.1 DNA-binding response regulator in two-component regulatory system with CusS NC_007793.3914065.p0 Protein 2e-34 41
cusR YP_006127940.1 DNA-binding response regulator in two-component regulatory system with CusS NC_002758.1121390.p0 Protein 2e-34 41
cusR YP_006127940.1 DNA-binding response regulator in two-component regulatory system with CusS NC_010079.5776364.p0 Protein 2e-34 41
cusR YP_006127940.1 DNA-binding response regulator in two-component regulatory system with CusS NC_002952.2859858.p0 Protein 2e-34 41
cusR YP_006127940.1 DNA-binding response regulator in two-component regulatory system with CusS NC_007622.3794948.p0 Protein 2e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_006127940.1 DNA-binding response regulator in two-component regulatory system with CusS VFG0596 Protein 1e-56 53
cusR YP_006127940.1 DNA-binding response regulator in two-component regulatory system with CusS VFG1390 Protein 3e-43 43
cusR YP_006127940.1 DNA-binding response regulator in two-component regulatory system with CusS VFG1389 Protein 6e-34 41