Gene Information

Name : Desdi_0560 (Desdi_0560)
Accession : YP_007219489.1
Strain : Desulfitobacterium dichloroeliminans LMG P-21439
Genome accession: NC_019903
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 580892 - 581572 bp
Length : 681 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
ATGAGCCCAAAAATCCTGATTATTGAGGACGAGGAAAAAATCGCCCGCTTTGTGGAACTTGAACTTAGTTATGAAGGGTA
CACCGTAGCCAAGGCCTATGATGGGCGAACGGGCCTTGAACTTGCGGAGACGGGTGACTTCGACTTGGTCCTGCTAGATG
TTATGCTACCAAAATTAAGCGGTACGGAGGTTCTGCGGAGAATTCGCCGGACCTCTGCCGTCCCCATCATTATGCTAACT
GCCCGGGATAGTGTGATGGATAAAGTCTCCGGTCTTGATAGCGGGGCAAATGATTACATCACTAAACCTTTTGCCATTGA
GGAACTTCTCGCTCGTATCCGTAACACCCTCAGAACGACCACAACGTTAAGCTCCACAGAGGTGTTATCTGCTTCTGGCC
TGAACCTTGATACGGACCGTCATACCGTAACGATGATGGGAAAGGCCATAGATTTAACGAAACGGGAATTTGACCTATTG
CACTTCCTCCTCAAAAACAAGGGAATCGTGGTGACACGGGAAGCACTCCTTGAACATGTCTGGGGCTACGACTTCACAGG
GGATACCAACTCCGTCGATGTCTACATCCGCTTCCTCCGCGGAAAAATTGACGAGGTATTTGATATTAAGCTCATTCACA
CCGTCAGAGGAGTAGGATATGTGATTAAAGATGAGAGATAA

Protein sequence :
MSPKILIIEDEEKIARFVELELSYEGYTVAKAYDGRTGLELAETGDFDLVLLDVMLPKLSGTEVLRRIRRTSAVPIIMLT
ARDSVMDKVSGLDSGANDYITKPFAIEELLARIRNTLRTTTTLSSTEVLSASGLNLDTDRHTVTMMGKAIDLTKREFDLL
HFLLKNKGIVVTREALLEHVWGYDFTGDTNSVDVYIRFLRGKIDEVFDIKLIHTVRGVGYVIKDER

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-41 48
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-41 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene1528. Protein 7e-48 53
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE015929.1.gene1106. Protein 9e-39 48
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 4e-44 47
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 4e-44 47
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 4e-44 47
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 4e-44 47
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 4e-44 47
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 4e-44 47
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 4e-44 47
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 4e-44 47
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0125 Protein 5e-38 47
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0197 Protein 2e-38 46
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0308 Protein 2e-36 45
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0638 Protein 2e-32 44
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_014475.1.orf0.gen Protein 3e-32 43
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_005054.2598277.p0 Protein 3e-32 43
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0111 Protein 2e-36 43
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 2e-30 43
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7685629. Protein 9e-36 42
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0083 Protein 1e-37 42
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0347 Protein 1e-32 42
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE000516.2.gene3505. Protein 6e-29 42
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7686381. Protein 3e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG0596 Protein 7e-42 48
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1390 Protein 2e-37 44
Desdi_0560 YP_007219489.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1389 Protein 5e-32 44